SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000349891 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000349891
Domain Number 1 Region: 34-255
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.05e-55
Family Ankyrin repeat 0.00029
Further Details:      
 
Weak hits

Sequence:  ENSP00000349891
Domain Number - Region: 648-751
Classification Level Classification E-value
Superfamily Tropomyosin 0.00288
Family Tropomyosin 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000349891   Gene: ENSG00000172014   Transcript: ENST00000357336
Sequence length 823
Comment pep:known chromosome:GRCh38:9:64369394:64413142:1 gene:ENSG00000172014 transcript:ENST00000357336 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLFGFGSRRGQTAQGSIDHVYTGSGYRIRDSELQKIHRAAVKGDAAEVERCLARRSGEL
DALDKQHRTALHLACASGHVQVVTLLVNRKCQIDVCDKENRTPLIQAVHCQEEACAVILL
EHGANPNLKDIYGNTALHYAVYSESTSLAEKLLSHGAHIEALDKDNNTPLLFAIICKKEK
MVEFLLKKKASSHAVDRLRRSALMLAVYYDSPGIVNILLKQNIDVFAQDMCGRDAEDYAI
SHHLTKIQQQILEHKKKILKKEKSDVGSSDESAVSIFHELRVDSLPASDDKDLNVATKQC
VPEKVSEPLPGSSHEKGNRIVNGQGEGPPAKHPSLKPSTEVEDPAVKGAVQRKNVQTLRA
EQALPVASEEEQQRHERSEKKQPQVKEGNNTNKSEKIQLSENICDSTSSAAAGRLTQQRK
IGKTYPQQFPKKLKEEHDRCTLKQENEEKTNVNMLYKKNREELERKEKQYKKEVEAKQLE
PTVQSLEMKSKTARNTPNWDFHNHEEMKGLMDENCILKADIAILRQEICTMKNDNLEKEN
KYLKDIKIVKETNAALEKYIKLNEEMITETAFRYQQELNDLKAENTRLNAELLKEKESKK
RLEADIESYQSRLAAAISKHSESVKTERNLKLALERTQDVSVQVEMSSAISKVKDENEFL
TEQLSETQIKFNALKDKFRKTRDSLRKKSLALETVQNNLSQTQQQTQEMKEMYQNAEAKV
NNSTGKWNCVEERICHLQRENAWLVQQLDDVHQKEDHKEIVTNIQRGFIESGKKDFVLEE
KSKKLMNECDHLKESLFQYEREKTEVVVSIKEDKYFQTSRKKI
Download sequence
Identical sequences Q4UJ75
9606.ENSP00000349891 ENSP00000349891 ENSP00000349891 gi|149363679|ref|NP_001092275.1| HR5234 NP_001092275.1.92137 ENSP00000349891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]