SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000353380 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000353380
Domain Number - Region: 123-173
Classification Level Classification E-value
Superfamily Cgl1923-like 0.00706
Family Cgl1923-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000353380   Gene: ENSG00000117362   Transcript: ENST00000360244
Sequence length 247
Comment pep:known chromosome:GRCh38:1:150265406:150269303:-1 gene:ENSG00000117362 transcript:ENST00000360244 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAAVFFGCTFVAFGPAFALFLITVAGDPLRVIILVAGAFFWLVSLLLASVVWFILVHVT
DRSDARLQYGLLIFGAAVSVLLQEVFRFAYYKLLKKADEGLASLSEDGRSPISIRQMAYV
SGLSFGIISGVFSVINILADALGPGVVGIHGDSPYYFLTSAFLTAAIILLHTFWGVVFFD
ACERRRYWALGLVVGSHLLTSGLTFLNPWYEASLLPIYAVTVSMGLWAFITAGGSLRSIQ
RSLLCKD
Download sequence
Identical sequences A0A2J8VEM2 F7FDJ7 G2HHW2 U3DKU7
ENSMMUP00000028174 NP_001267034.1.37143 NP_057106.2.87134 NP_057106.2.92137 ENSP00000353380 ENSP00000464506 gi|117606357|ref|NP_057106.2| ENSP00000353380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]