SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000353739 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000353739
Domain Number 1 Region: 74-313
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 2.05e-33
Family Protein-L-isoaspartyl O-methyltransferase 0.004
Further Details:      
 
Weak hits

Sequence:  ENSP00000353739
Domain Number - Region: 337-354
Classification Level Classification E-value
Superfamily SOCS box-like 0.0667
Family SOCS box-like 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000353739   Gene: ENSG00000168300   Transcript: ENST00000360540
Sequence length 357
Comment pep:known chromosome:GRCh38:8:51817580:51899098:-1 gene:ENSG00000168300 transcript:ENST00000360540 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGAVSAGEDNDDLIDNLKEAQYIRTERVEQAFRAIDRGDYYLEGYRDNAYKDLAWKHGN
IHLSAPCIYSEVMEALKLQPGLSFLNLGSGTGYLSTMVGLILGPFGINHGIELHSDVVEY
AKEKLESFIKNSDSFDKFEFCEPAFVVGNCLQIASDSHQYDRIYCGAGVQKDHENYMKIL
LKVGGILVMPIEDQLTQIMRTGQNTWESKNILAVSFAPLVQPSKNDNGKPDSVGLPPCAV
RNLQDLARIYIRRTLRNFINDEMQAKGIPQRAPPKRKRKRVKQRINTYVFVGNQLIPQPL
DSEEDEKMEEDNKEEEEKDHNEAMKPEEPPQNLLREKIMKLPLPESLKAYLTYFRDK
Download sequence
Identical sequences A0A2J8UN15 G3S020 H2QW55 K9IXF7 Q5R7E5 Q96MG8
9598.ENSPTRP00000034666 9600.ENSPPYP00000020838 9606.ENSP00000353739 ENSPPYP00000020838 ENSP00000353739 ENSP00000428099 ENSP00000353739 ENSP00000428099 ENSGGOP00000021413 ENSGGOP00000017280 NP_001125991.1.23681 NP_443169.2.87134 NP_443169.2.92137 XP_003823307.1.60992 XP_004047046.1.27298 XP_008975115.1.60992 XP_008975116.1.60992 XP_008975117.1.60992 XP_008975118.1.60992 XP_008975121.1.60992 XP_009242068.1.23681 XP_009453633.1.37143 XP_014201414.1.60992 XP_014201415.1.60992 XP_014201416.1.60992 XP_016814950.1.37143 XP_018888225.1.27298 XP_519755.3.37143 ENSP00000353739 ENSPTRP00000034666 ENSPTRP00000034666 ENSPPYP00000020838 gi|190360566|ref|NP_443169.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]