SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000354547 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000354547
Domain Number 1 Region: 315-372
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.17e-25
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 2 Region: 69-130
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.98e-25
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 3 Region: 427-484
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.79e-24
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 4 Region: 371-428
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.82e-21
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 5 Region: 469-521
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.71e-20
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 6 Region: 277-329
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.37e-19
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Weak hits

Sequence:  ENSP00000354547
Domain Number - Region: 2-39
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 0.000325
Family SCAN domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000354547   Gene: ENSG00000187801   Transcript: ENST00000361584
Sequence length 534
Comment pep:known chromosome:GRCh38:1:40450665:40463716:1 gene:ENSG00000187801 transcript:ENST00000361584 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQQLLITLPTEASTWVKLRHPKAATERVALWEDVTKMFKAEALLSQDADETQGESLESR
VTLGSLTAESQELLTFKDVSVDFTQEEWGQLAPAHRNLYREVMLENYGNLVSVGCQLSKP
GVISQLEKGEEPWLMERDISGVPSSDLKSKTKTKESALQNDISWEELHCGLMMERFTKGS
SMYSTLGRISKCNKLESQQENQRMGKGQIPLMCKKTFTQERGQESNRFEKRINVKSEVMP
GPIGLPRKRDRKYDTPGKRSRYNIDLVNHSRSYTKMKTFECNICEKIFKQLIHLTEHMRI
HTGEKPFRCKECGKAFSQSSSLIPHQRIHTGEKPYECKECGKTFRHPSSLTQHVRIHTGE
KPYECRVCEKAFSQSIGLIQHLRTHVREKPFTCKDCGKAFFQIRHLRQHEIIHTGVKPYI
CNVCSKTFSHSTYLTQHQRTHTGERPYKCKECGKAFSQRIHLSIHQRVHTGVKPYECSHC
GKAFRHDSSFAKHQRIHTGEKPYDCNECGKAFSCSSSLIRHCKTHLRNTFSNVV
Download sequence
Identical sequences D3DPV3 Q9UJL9
ENSP00000399664 gi|296317246|ref|NP_075558.2| ENSP00000399664 ENSP00000354547 ENSP00000399664 NP_075558.2.87134 NP_075558.2.92137 XP_005271194.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]