SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000355010 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000355010
Domain Number 1 Region: 1064-1158
Classification Level Classification E-value
Superfamily Immunoglobulin 1.05e-23
Family I set domains 0.0037
Further Details:      
 
Domain Number 2 Region: 776-869
Classification Level Classification E-value
Superfamily Immunoglobulin 2.89e-23
Family I set domains 0.015
Further Details:      
 
Domain Number 3 Region: 129-223
Classification Level Classification E-value
Superfamily Immunoglobulin 3.14e-21
Family I set domains 0.012
Further Details:      
 
Domain Number 4 Region: 872-966
Classification Level Classification E-value
Superfamily Immunoglobulin 1.28e-20
Family I set domains 0.0076
Further Details:      
 
Domain Number 5 Region: 1160-1247
Classification Level Classification E-value
Superfamily Immunoglobulin 1.28e-19
Family I set domains 0.0066
Further Details:      
 
Domain Number 6 Region: 968-1062
Classification Level Classification E-value
Superfamily Immunoglobulin 4.1e-19
Family I set domains 0.0034
Further Details:      
 
Domain Number 7 Region: 418-505
Classification Level Classification E-value
Superfamily Immunoglobulin 7.99e-19
Family I set domains 0.01
Further Details:      
 
Domain Number 8 Region: 320-415
Classification Level Classification E-value
Superfamily Immunoglobulin 2.84e-18
Family I set domains 0.016
Further Details:      
 
Domain Number 9 Region: 224-318
Classification Level Classification E-value
Superfamily Immunoglobulin 6.22e-17
Family I set domains 0.0092
Further Details:      
 
Domain Number 10 Region: 683-773
Classification Level Classification E-value
Superfamily Immunoglobulin 4.2e-16
Family I set domains 0.0046
Further Details:      
 
Domain Number 11 Region: 36-125
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000016
Family I set domains 0.0076
Further Details:      
 
Domain Number 12 Region: 589-680
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000318
Family I set domains 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000355010   Gene: ENSG00000147255   Transcript: ENST00000361420
Sequence length 1336
Comment pep:known chromosome:GRCh38:X:131273509:131289226:-1 gene:ENSG00000147255 transcript:ENST00000361420 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLDRPGEGATMLKTFTVLLFCIRMSLGMTSIVMDPQPELWIESNYPQAPWENITLWCRS
PSRISSKFLLLKDKTQMTWIRPSHKTFQVSFLIGALTESNAGLYRCCYWKETGWSKPSKV
LELEAPGQLPKPIFWIQAETPALPGCNVNILCHGWLQDLVFMLFKEGYAEPVDYQVPTGT
MAIFSIDNLTPEDEGVYICRTHIQMLPTLWSEPSNPLKLVVAGLYPKPTLTAHPGPIMAP
GESLNLRCQGPIYGMTFALMRVEDLEKSFYHKKTIKNEANFFFQSLKIQDTGHYLCFYYD
ASYRGSLLSDVLKIWVTDTFPKTWLLARPSAVVQMGQNVSLRCRGPVDGVGLALYKKGED
KPLQFLDATSIDDNTSFFLNNVTYSDTGIYSCHYLLTWKTSIRMPSHNTVELMVVDKPPK
PSLSAWPSTVFKLGKAITLQCRVSHPVLEFSLEWEERETFQKFSVNGDFIISNVDGKGTG
TYSCSYRVETHPNIWSHRSEPLKLMGPAGYLTWNYVLNEAIRLSLIMQLVALLLVVLWIR
WKCRRLRIREAWLLGTAQGVTMLFIVTALLCCGLCNGVLIEETEIVMPTPKPELWAETNF
PLAPWKNLTLWCRSPSGSTKEFVLLKDGTGWIATRPASEQVRAAFPLGALTQSHTGSYHC
HSWEEMAVSEPSEALELVGTDILPKPVISASPTIRGQELQLRCKGWLAGMGFALYKEGEQ
EPVQQLGAVGREAFFTIQRMEDKDEGNYSCRTHTEKRPFKWSEPSEPLELVIKEMYPKPF
FKTWASPVVTPGARVTFNCSTPHQHMSFILYKDGSEIASSDRSWASPGASAAHFLIISVG
IGDGGNYSCRYYDFSIWSEPSDPVELVVTEFYPKPTLLAQPGPVVFPGKSVILRCQGTFQ
GMRFALLQEGAHVPLQFRSVSGNSADFLLHTVGAEDSGNYSCIYYETTMSNRGSYLSMPL
MIWVTDTFPKPWLFAEPSSVVPMGQNVTLWCRGPVHGVGYILHKEGEATSMQLWGSTSND
GAFPITNISGTSMGRYSCCYHPDWTSSIKIQPSNTLELLVTGLLPKPSLLAQPGPMVAPG
ENMTLQCQGELPDSTFVLLKEGAQEPLEQQRPSGYRADFWMPAVRGEDSGIYSCVYYLDS
TPFAASNHSDSLEIWVTDKPPKPSLSAWPSTMFKLGKDITLQCRGPLPGVEFVLEHDGEE
APQQFSEDGDFVINNVEGKGIGNYSCSYRLQAYPDIWSEPSDPLELVGAAGPVAQECTVG
NIVRSSLIVVVVVALGVVLAIEWKKWPRLRTRGSETDGRDQTIALEECNQEGEPGTPANS
PSSTSQRISVELPVPI
Download sequence
Identical sequences Q8N6C5
gi|45505167|ref|NP_001546.2| NYSGRC-IgSF-IGSF1_HUMAN 9606.ENSP00000355010 ENSP00000355010 NP_001546.2.87134 NP_001546.2.92137 ENSP00000355010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]