SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000355124 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000355124
Domain Number 1 Region: 308-386
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 2.44e-24
Family Intermediate filament protein, coiled coil region 0.0011
Further Details:      
 
Domain Number 2 Region: 78-112
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000022
Family Intermediate filament protein, coiled coil region 0.0022
Further Details:      
 
Domain Number 3 Region: 190-304
Classification Level Classification E-value
Superfamily Prefoldin 0.000000497
Family Prefoldin 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000355124   Gene: ENSG00000171345   Transcript: ENST00000361566
Sequence length 400
Comment pep:known chromosome:GRCh38:17:41523617:41528308:-1 gene:ENSG00000171345 transcript:ENST00000361566 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSYSYRQSSATSSFGGLGGGSVRFGPGVAFRAPSIHGGSGGRGVSVSSARFVSSSSSGA
YGGGYGGVLTASDGLLAGNEKLTMQNLNDRLASYLDKVRALEAANGELEVKIRDWYQKQG
PGPSRDYSHYYTTIQDLRDKILGATIENSRIVLQIDNARLAADDFRTKFETEQALRMSVE
ADINGLRRVLDELTLARTDLEMQIEGLKEELAYLKKNHEEEISTLRGQVGGQVSVEVDSA
PGTDLAKILSDMRSQYEVMAEQNRKDAEAWFTSRTEELNREVAGHTEQLQMSRSEVTDLR
RTLQGLEIELQSQLSMKAALEDTLAETEARFGAQLAHIQALISGIEAQLGDVRADSERQN
QEYQRLMDIKSRLEQEIATYRSLLEGQEDHYNNLSASKVL
Download sequence
Identical sequences P08727
ENSP00000355124 ENSP00000355124 ENSP00000355124 gi|24234699|ref|NP_002267.2| 9606.ENSP00000355124 NYSGXRC-13050a NP_002267.2.87134 NP_002267.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]