SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000358217 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000358217
Domain Number 1 Region: 573-623
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000389
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 610-656
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000174
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 3 Region: 90-120
Classification Level Classification E-value
Superfamily SET domain 0.00000549
Family Histone lysine methyltransferases 0.057
Further Details:      
 
Domain Number 4 Region: 132-160
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000867
Family C2HC finger 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000358217   Gene: ENSG00000112238   Transcript: ENST00000369215
Sequence length 707
Comment pep:known chromosome:GRCh38:6:99606730:99614759:1 gene:ENSG00000112238 transcript:ENST00000369215 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHGAARAPATSVSADCCIPAGLRLGPVPGTFKLGKYLSDRREPGPKKKVRMVRGELVDES
GGSPLEWIGLIRAARNSQEQTLEAIADLPGGQIFYRALRDVQPGEELTVWYSNSLAQWFD
IPTTATPTHDEKGEERYICWYCWRTFRYPNSLKAHLRFHCVFSGGGGGAFLHHEHAARQG
AVPAADGLGLSPKPPAPDFAAPSQAGTLRPHPLGPPPVQACGAREGIKREASSAPSATSP
TPGKWGQPKKGKEQLDRALDMSGAARGQGHFLGIVGGSSAGVGSLAFYPGVRSAFKPAGL
ARAAAAAHGDPYREESSSKQGAGLALGRLLGGGRACGRPGSGENSAAGGAGHHHHHHAHH
HHHPKCLLAGDPPPPPPPGLPCSGALRGFPLLSVPPEEASAFKHVERAPPAAAALPGARY
AQLPPAPGLPLERCALPPLDPGGLKAYPGGECSHLPAVMPAFTVYNGELLYGSPATTAYY
PLKLHFGGLLKYPESISYFSGPAAAALSPAELGSLASIDREIAMHNQQLSEMAAGKGRGR
LDSGTLPPAVAAAGGTGGGGSGGSGAGKPKTGHLCLYCGKLYSRKYGLKIHMRTHTGYKP
LKCKVCLRPFGDPSNLNKHIRLHAEGNTPYRCEFCGKVLVRRRDLERHVKSRHPGQSLLA
KAGDGPGAEPGYPPEPGDPKSDDSDVDVCFTDDQSDPEVGGGGERDL
Download sequence
Identical sequences Q9H4Q3
9606.ENSP00000358217 ENSP00000358217 ENSP00000358217 NP_067633.2.87134 NP_067633.2.92137 gi|124107614|ref|NP_067633.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]