SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000359947 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000359947
Domain Number 1 Region: 1055-1149
Classification Level Classification E-value
Superfamily Immunoglobulin 1.04e-23
Family I set domains 0.0037
Further Details:      
 
Domain Number 2 Region: 767-860
Classification Level Classification E-value
Superfamily Immunoglobulin 2.89e-23
Family I set domains 0.015
Further Details:      
 
Domain Number 3 Region: 120-214
Classification Level Classification E-value
Superfamily Immunoglobulin 3.14e-21
Family I set domains 0.012
Further Details:      
 
Domain Number 4 Region: 863-957
Classification Level Classification E-value
Superfamily Immunoglobulin 1.27e-20
Family I set domains 0.0076
Further Details:      
 
Domain Number 5 Region: 1151-1238
Classification Level Classification E-value
Superfamily Immunoglobulin 1.28e-19
Family I set domains 0.0066
Further Details:      
 
Domain Number 6 Region: 959-1053
Classification Level Classification E-value
Superfamily Immunoglobulin 4.1e-19
Family I set domains 0.0034
Further Details:      
 
Domain Number 7 Region: 409-496
Classification Level Classification E-value
Superfamily Immunoglobulin 7.99e-19
Family I set domains 0.01
Further Details:      
 
Domain Number 8 Region: 311-406
Classification Level Classification E-value
Superfamily Immunoglobulin 2.84e-18
Family I set domains 0.016
Further Details:      
 
Domain Number 9 Region: 215-309
Classification Level Classification E-value
Superfamily Immunoglobulin 6.22e-17
Family I set domains 0.0092
Further Details:      
 
Domain Number 10 Region: 674-764
Classification Level Classification E-value
Superfamily Immunoglobulin 4.15e-16
Family I set domains 0.0046
Further Details:      
 
Domain Number 11 Region: 27-116
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000105
Family I set domains 0.0076
Further Details:      
 
Domain Number 12 Region: 580-671
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000316
Family I set domains 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000359947   Gene: ENSG00000147255   Transcript: ENST00000370910
Sequence length 1327
Comment pep:known chromosome:GRCh38:X:131273506:131289278:-1 gene:ENSG00000147255 transcript:ENST00000370910 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLDRPGEGATMLKTFTVLLFCILMDPQPELWIESNYPQAPWENITLWCRSPSRISSKFL
LLKDKTQMTWIRPSHKTFQVSFLIGALTESNAGLYRCCYWKETGWSKPSKVLELEAPGQL
PKPIFWIQAETPALPGCNVNILCHGWLQDLVFMLFKEGYAEPVDYQVPTGTMAIFSIDNL
TPEDEGVYICRTHIQMLPTLWSEPSNPLKLVVAGLYPKPTLTAHPGPIMAPGESLNLRCQ
GPIYGMTFALMRVEDLEKSFYHKKTIKNEANFFFQSLKIQDTGHYLCFYYDASYRGSLLS
DVLKIWVTDTFPKTWLLARPSAVVQMGQNVSLRCRGPVDGVGLALYKKGEDKPLQFLDAT
SIDDNTSFFLNNVTYSDTGIYSCHYLLTWKTSIRMPSHNTVELMVVDKPPKPSLSAWPST
VFKLGKAITLQCRVSHPVLEFSLEWEERETFQKFSVNGDFIISNVDGKGTGTYSCSYRVE
THPNIWSHRSEPLKLMGPAGYLTWNYVLNEAIRLSLIMQLVALLLVVLWIRWKCRRLRIR
EAWLLGTAQGVTMLFIVTALLCCGLCNGVLIEETEIVMPTPKPELWAETNFPLAPWKNLT
LWCRSPSGSTKEFVLLKDGTGWIATRPASEQVRAAFPLGALTQSHTGSYHCHSWEEMAVS
EPSEALELVGTDILPKPVISASPTIRGQELQLRCKGWLAGMGFALYKEGEQEPVQQLGAV
GREAFFTIQRMEDKDEGNYSCRTHTEKRPFKWSEPSEPLELVIKEMYPKPFFKTWASPVV
TPGARVTFNCSTPHQHMSFILYKDGSEIASSDRSWASPGASAAHFLIISVGIGDGGNYSC
RYYDFSIWSEPSDPVELVVTEFYPKPTLLAQPGPVVFPGKSVILRCQGTFQGMRFALLQE
GAHVPLQFRSVSGNSADFLLHTVGAEDSGNYSCIYYETTMSNRGSYLSMPLMIWVTDTFP
KPWLFAEPSSVVPMGQNVTLWCRGPVHGVGYILHKEGEATSMQLWGSTSNDGAFPITNIS
GTSMGRYSCCYHPDWTSSIKIQPSNTLELLVTGLLPKPSLLAQPGPMVAPGENMTLQCQG
ELPDSTFVLLKEGAQEPLEQQRPSGYRADFWMPAVRGEDSGIYSCVYYLDSTPFAASNHS
DSLEIWVTDKPPKPSLSAWPSTMFKLGKDITLQCRGPLPGVEFVLEHDGEEAPQQFSEDG
DFVINNVEGKGIGNYSCSYRLQAYPDIWSEPSDPLELVGAAGPVAQECTVGNIVRSSLIV
VVVVALGVVLAIEWKKWPRLRTRGSETDGRDQTIALEECNQEGEPGTPANSPSSTSQRIS
VELPVPI
Download sequence
Identical sequences gi|283436133|ref|NP_001164433.1| NP_001164433.1.87134 NP_001164433.1.92137 ENSP00000359941 ENSP00000359947 ENSP00000359941 ENSP00000359947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]