SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000360262 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000360262
Domain Number 1 Region: 289-568
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.18e-52
Family Glycerol kinase 0.0046
Further Details:      
 
Domain Number 2 Region: 11-268
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.3e-52
Family Glycerol kinase 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000360262   Gene: ENSG00000172456   Transcript: ENST00000371218
Sequence length 575
Comment pep:novel chromosome:GRCh38:1:59296981:59762724:1 gene:ENSG00000172456 transcript:ENST00000371218 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGGEQKPERYYVGVDVGTGSVRAALVDQSGVLLAFADQPIKNWEPQFNHHEQSSEDIWA
ACCVVTKKVVQGIDLNQIRGLGFDATCSLVVLDKQFHPLPVNQEGDSHRNVIMWLDHRAV
SQVNRINETKHSVLQYVGGVMSVEMQAPKLLWLKENLREICWDKAGHFFDLPDFLSWKAT
GVTARSLCSLVCKWTYSAEKGWDDSFWKMIGLEDFVADNYSKIGNQVLPPGASLGNGLTP
EAARDLGLLPGIAVAASLIDAHAGGLGVIGADVRGHGLICEGQPVTSRLAVICGTSSCHM
GISKDPIFVPGVWGPYFSAMVPGFWLNEGGQSVTGKLIDHMVQGHAAFPELQVKATARCQ
SIYAYLNSHLDLIKKAQPVGFLTVDLHVWPDFHGNRSPLADLTLKGMRTTGYLYIPALAA
LHSPSSLLSPQVTGLKLSQDLDDLAILYLATVQAIALGTRFIIEAMEAAGHSISTLFLCG
GLSKNPLFVQMHADITGMPVVLSQEVESVLVGAAVLGACASGDFASVQEAMAKMSKVGKV
VFPRLQDKKYYDKKYQVFLKLVEHQKEYLAIMNDD
Download sequence
Identical sequences ENSP00000360262 9606.ENSP00000360262 ENSP00000360262 ENSP00000360254 NP_001106882.1.87134 NP_001106882.1.92137 XP_011540032.1.92137 XP_011540033.1.92137 XP_011540034.1.92137 XP_011540035.1.92137 XP_016857132.1.92137 XP_016857133.1.92137 gi|164663830|ref|NP_001106882.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]