SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000360281 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000360281
Domain Number 1 Region: 544-590
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000327
Family TSP-1 type 1 repeat 0.00074
Further Details:      
 
Domain Number 2 Region: 123-156
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000118
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 3 Region: 63-112
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000301
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Weak hits

Sequence:  ENSP00000360281
Domain Number - Region: 499-539
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0879
Family EGF-type module 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000360281   Gene: ENSG00000021852   Transcript: ENST00000371237
Sequence length 591
Comment pep:known chromosome:GRCh38:1:56929210:56966015:-1 gene:ENSG00000021852 transcript:ENST00000371237 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKNSRTWAWRAPVELFLLCAALGCLSLPGSRGERPHSFGSNAVNKSFAKSRQMRSVDVTL
MPIDCELSSWSSWTTCDPCQKKRYRYAYLLQPSQFHGEPCNFSDKEVEDCVTNRPCGSQV
RCEGFVCAQTGRCVNRRLLCNGDNDCGDQSDEANCRRIYKKCQHEMDQYWGIGSLASGIN
LFTNSFEGPVLDHRYYAGGCSPHYILNTRFRKPYNVESYTPQTQGKYEFILKEYESYSDF
ERNVTEKMASKSGFSFGFKIPGIFELGISSQSDRGKHYIRRTKRFSHTKSVFLHARSDLE
VAHYKLKPRSLMLHYEFLQRVKRLPLEYSYGEYRDLFRDFGTHYITEAVLGGIYEYTLVM
NKEAMERGDYTLNNVHACAKNDFKIGGAIEEVYVSLGVSVGKCRGILNEIKDRNKRDTMV
EDLVVLVRGGASEHITTLAYQELPTADLMQEWGDAVQYNPAIIKVKVEPLYELVTATDFA
YSSTVRQNMKQALEEFQKEVSSCHCAPCQGNGVPVLKGSRCDCICPVGSQGLACEVSYRK
NTPIDGKWNCWSNWSSCSGRRKTRQRQCNNPPPQNGGSPCSGPASETLDCS
Download sequence
Identical sequences gi|4557391|ref|NP_000057.1| ENSP00000360281 XP_016857724.1.92137 9606.ENSP00000360281 ENSP00000360281 NYSGRC-4557391 ENSP00000360281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]