SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000361790 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000361790
Domain Number 1 Region: 280-336
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.59e-25
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 2 Region: 71-132
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.09e-23
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 3 Region: 363-420
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-21
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 4 Region: 419-476
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.55e-21
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 5 Region: 461-513
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.64e-18
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 6 Region: 326-358
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000248
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Weak hits

Sequence:  ENSP00000361790
Domain Number - Region: 229-280
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00182
Family Classic zinc finger, C2H2 0.038
Further Details:      
 
Domain Number - Region: 3-40
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 0.0033
Family SCAN domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000361790   Gene: ENSG00000187815   Transcript: ENST00000372705
Sequence length 526
Comment pep:known chromosome:GRCh38:1:40477630:40496288:1 gene:ENSG00000187815 transcript:ENST00000372705 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQQLLITLPTEASTWVKLQHPKKAVEGAPLWEDVTKMFEGEALLSQDAEDVKTQRESLE
DEVTPGLPTAESQELLTFKDISIDFTQEEWGQLAPAHQNLYREVMLENYSNLVSVGYQLS
KPSVISQLEKGEEPWMAEKEGPGDPSSDLKSKIETIESTAKSTISQERLYHGIMMESFMR
DDIIYSTLRKVSTYDDVLERHQETCMRDVRQAILTHKKRVQETNKFGENIIVHSNVIIEQ
RHHKYDTPTKRNTYKLDLINHPTSYIRTKTYECNICEKIFKQPIHLTEHMRIHTGEKPFR
CKECGRAFSQSASLSTHQRIHTGEKPFECEECGKAFRHRSSLNQHHRTHTGEKPYVCDKC
QKAFSQNISLVQHLRTHSGEKPFTCNECGKTFRQIRHLSEHIRIHTGEKPYACTACCKTF
SHRAYLTHHQRIHTGERPYKCKECGKAFRQRIHLSNHKTVHTGVKAYECNRCGKAYRHDS
SFKKHQRHHTGEKPYECNECGKAFSYNSSLSRHHEIHRRNAFRNKV
Download sequence
Identical sequences Q49AA0
ENSP00000361790 ENSP00000361791 NP_001307108.1.87134 NP_001307108.1.92137 NP_940896.2.87134 NP_940896.2.92137 XP_006710669.1.92137 ENSP00000361790 ENSP00000361790 ENSP00000361791 gi|93004100|ref|NP_940896.2| 9606.ENSP00000361790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]