SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000363317 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000363317
Domain Number 1 Region: 935-1040
Classification Level Classification E-value
Superfamily PDZ domain-like 2.1e-26
Family PDZ domain 0.00082
Further Details:      
 
Domain Number 2 Region: 543-678
Classification Level Classification E-value
Superfamily PH domain-like 6.15e-26
Family Third domain of FERM 0.0041
Further Details:      
 
Domain Number 3 Region: 437-542
Classification Level Classification E-value
Superfamily Second domain of FERM 1.96e-24
Family Second domain of FERM 0.00086
Further Details:      
 
Domain Number 4 Region: 763-859
Classification Level Classification E-value
Superfamily PDZ domain-like 7.23e-22
Family PDZ domain 0.016
Further Details:      
 
Domain Number 5 Region: 1062-1170
Classification Level Classification E-value
Superfamily PDZ domain-like 1.21e-20
Family PDZ domain 0.023
Further Details:      
 
Domain Number 6 Region: 343-432
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000062
Family First domain of FERM 0.044
Further Details:      
 
Weak hits

Sequence:  ENSP00000363317
Domain Number - Region: 79-163
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00033
Family Protein kinases, catalytic subunit 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000363317   Gene: ENSG00000170324   Transcript: ENST00000374201
Sequence length 1309
Comment pep:known chromosome:GRCh38:10:48156558:48274870:-1 gene:ENSG00000170324 transcript:ENST00000374201 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPLTKDAGMSLSSVTLASALQVRGEALSEEEIWSLLFLAAEQLLEDLRNDSSDYVVCPW
SALLSAAGSLSFQGRVSHIEAAPFKAPELLQGQSEDEQPDASQMHVYSLGMTLYWSAGFH
VPPHQPLQLCEPLHSILLTMCEDQPHRRCTLQSVLEACRVHEKEVSVYPAPAGLHIRRLV
GLVLGTISEVEKRVVEESSSVQQNRSYLLRKRLRGTSSESPAAQAPECLHPCRVSERSTE
TQSSPEPHWSTLTHSHCSLLVNRALPGADPQDQQAGRRLSSGSVHSAADSSWPTTPSQRG
FLQRRSKFSRPEFILLAGEAPMTLHLPGSVVTKKGKSYLALRDLCVVLLNGQHLEVKCDV
ESTVGAVFNAVTSFANLEELTYFGLAYMKSKEFFFLDSETRLCKIAPEGWREQPQKTSMN
TFTLFLRIKFFVSHYGLLQHSLTRHQFYLQLRKDILEERLYCNEEILLQLGVLALQAEFG
NYPKEQVESKPYFHVEDYIPASLIERMTALRVQVEVSEMHRLSSALWGEDAELKFLRVTQ
QLPEYGVLVHQVFSEKRRPEEEMALGICAKGVIVYEVKNNSRIAMLRFQWRETGKISTYQ
KKFTITSSVTGKKHTFVTDSAKTSKYLLDLCSAQHGFNAQMGSGQPSHVLFDHDKFVQMA
NLSPAHQARSKPLIWIQRLSCSENELFVSRLQGAAGGLLSTSMDNFNVDGSKEAGAEGIG
RSPCTGREQLKSACVIQKPMTWDSLSGPPVQSMHAGSKNNRRKSFIAEPGREIVRVTLKR
DPHRGFGFVINEGEYSGQADPGIFISSIIPGGPAEKAKTIKPGGQILALNHISLEGFTFN
MAVRMIQNSPDNIELIISQSKGVGGNNPDEEKNSTANSGVSSTDILSFGYQGSLLSHTQD
QDRNTEELDMAGVQSLVPRLRHQLSFLPLKGAGSSCPPSPPEISAGEIYFVELVKEDGTL
GFSVTGGINTSVPYGGIYVKSIVPGGPAAKEGQILQGDRLLQVDGVILCGLTHKQAVQCL
TGPGQVARLVLERRVPRSTQQCPSANDSMGDERTAVSLVTALPGRPSSCVSVTDGPKFEV
KLKKNANGLGFSFVQMEKESCSHLKSDLVRIKRLFPGQPAEENGAIAAGDIILAVNGRST
EGLIFQEVLHLLRGAPQEVTLLLCRPPPGALPELEQEWQTPELSADKEFTRATCTDSCTS
PILDQEDSWRDSASPDAGEGLGLRPESSQKAIREAQWGQNRERPWASSLTHSPESHPHLC
KLHQERDESTLATSLEKDVRQNCYSVCDIMRLGRYSFSSPLTRLSTDIF
Download sequence
Identical sequences Q68DX3
9606.ENSP00000363317 ENSP00000363317 ENSP00000307079 ENSP00000363317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]