SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000365273 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000365273
Domain Number 1 Region: 68-113
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000327
Family HLH, helix-loop-helix DNA-binding domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000365273   Gene: ENSG00000125968   Transcript: ENST00000376105
Sequence length 149
Comment pep:known chromosome:GRCh38:20:31605283:31606515:1 gene:ENSG00000125968 transcript:ENST00000376105 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQ
QVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGG
RGLPVRAPLSTLNGEISALTAEVRSRSDH
Download sequence
Identical sequences K7CP80
gi|31317297|ref|NP_851998.1| ENSP00000365273 hst001000495.1 hst001000495.2 NP_851998.1.87134 NP_851998.1.92137 ENSP00000365273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]