SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000365280 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000365280
Domain Number 1 Region: 68-113
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000366
Family HLH, helix-loop-helix DNA-binding domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000365280   Gene: ENSG00000125968   Transcript: ENST00000376112
Sequence length 155
Comment pep:known chromosome:GRCh38:20:31605283:31606515:1 gene:ENSG00000125968 transcript:ENST00000376112 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQ
QVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGG
RGLPVRAPLSTLNGEISALTAEAACVPADDRILCR
Download sequence
Identical sequences G3RJ48 H2RDX7 P41134
ENSGGOP00000015723 ENSP00000365273 9598.ENSPTRP00000059507 9606.ENSP00000365280 GO.78733 HR3123 ENSP00000365280 ENSP00000365280 ENSPTRP00000059507 ENSGGOP00000015723 ENSPTRP00000059507 gi|31317299|ref|NP_002156.2| NP_002156.2.87134 NP_002156.2.92137 XP_001152873.1.37143 XP_004061997.1.27298 XP_016802578.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]