SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000365687 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000365687
Domain Number 1 Region: 163-222
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.57e-19
Family HLH, helix-loop-helix DNA-binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000365687   Gene: ENSG00000168267   Transcript: ENST00000376504
Sequence length 328
Comment pep:known chromosome:GRCh38:10:23192327:23194252:1 gene:ENSG00000168267 transcript:ENST00000376504 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAVLLEHFPGGLDAFPSSYFDEDDFFTDQSSRDPLEDGDELLADEQAEVEFLSHQLHEY
CYRDGACLLLQPAPPAAPLALAPPSSGGLGEPDDGGGGGYCCETGAPPGGFPYSPGSPPS
CLAYPCAGAAVLSPGARLRGLSGAAAAAARRRRRVRSEAELQQLRQAANVRERRRMQSIN
DAFEGLRSHIPTLPYEKRLSKVDTLRLAIGYINFLSELVQADLPLRGGGAGGCGGPGGGG
RLGGDSPGSQAQKVIICHRGTRSPSPSDPDYGLPPLAGHSLSWTDEKQLKEQNIIRTAKV
WTPEDPRKLNSKSSFNNIENEPPFEFVS
Download sequence
Identical sequences Q7RTS3
9606.ENSP00000365687 gi|30039710|ref|NP_835455.1| ENSP00000365687 NP_835455.1.87134 NP_835455.1.92137 ENSP00000365687 ENSP00000365687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]