SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000367130 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000367130
Domain Number 1 Region: 1-54
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000111
Family HLH, helix-loop-helix DNA-binding domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000367130   Gene: ENSG00000173673   Transcript: ENST00000377898
Sequence length 186
Comment pep:known chromosome:GRCh38:1:6244192:6245578:1 gene:ENSG00000173673 transcript:ENST00000377898 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKKRRARINVSLEQLKSLLEKHYSHQIRKRKLEKADILELSVKYMRSLQNSLQGLWPVP
RGAEQPSGFRSCLPGVSQLLRRGDEVGSGLRCPLVPESAAGSTMDSAGLGQEAPALFRPC
TPAVWAPAPAAGGPRSPPPLLLLPESLPGSSASVPPPQPASSRCAESPGLGLRVWRPWGS
PGDDLN
Download sequence
Identical sequences Q5TGS1
9606.ENSP00000367130 ENSP00000367130 ENSP00000367130 gi|66912172|ref|NP_001019769.1| NP_001019769.1.87134 NP_001019769.1.92137 ENSP00000367130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]