SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000367794 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000367794
Domain Number 1 Region: 261-319
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000195
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 2 Region: 114-175
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000208
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 3 Region: 77-129
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000667
Family Complement control module/SCR domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000367794   Gene: ENSG00000101955   Transcript: ENST00000378533
Sequence length 464
Comment pep:known chromosome:GRCh38:X:38149339:38220899:-1 gene:ENSG00000101955 transcript:ENST00000378533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSPAHRPALLLLLPPLLLLLLLRVPPSRSFPGSGDSPLEDDEVGYSHPRYKDTPWCSPI
KVKYGDVYCRAPQGGYYKTALGTRCDIRCQKGYELHGSSLLICQSNKRWSDKVICKQKRC
PTLAMPANGGFKCVDGAYFNSRCEYYCSPGYTLKGERTVTCMDNKAWSGRPASCVDMEPP
RIKCPSVKERIAEPNKLTVRVSWETPEGRDTADGILTDVILKGLPPGSNFPEGDHKIQYT
VYDRAENKGTCKFRVKVRVKRCGKLNAPENGYMKCSSDGDNYGATCEFSCIGGYELQGSP
ARVCQSNLAWSGTEPTCAAMNVNVGVRTAAALLDQFYEKRRLLIVSTPTARNLLYRLQLG
MLQQAQCGLDLRHITVVELVGVFPTLIGRIGAKIMPPALALQLRLLLRIPLYSFSMVLVD
KHGMDKERYVSLVMPVALFNLIDTFPLRKEEMVLQAEMSQTCNT
Download sequence
Identical sequences G3RY54 K7B5Z1 P78539
ENSGGOP00000020741 ENSP00000367794 NP_006298.1.87134 NP_006298.1.92137 XP_004064042.1.27298 XP_016799387.1.37143 gi|5454086|ref|NP_006298.1| ENSGGOP00000020741 ENSP00000339211 ENSP00000367794 hsi002013589.1 hsi002013589.2 9606.ENSP00000367794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]