SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000368678 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000368678
Domain Number 1 Region: 36-160
Classification Level Classification E-value
Superfamily TIMP-like 2.12e-55
Family The laminin-binding domain of agrin 0.000000587
Further Details:      
 
Domain Number 2 Region: 1351-1558
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.77e-45
Family Laminin G-like module 0.00024
Further Details:      
 
Domain Number 3 Region: 1837-2043
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.81e-40
Family Laminin G-like module 0.000000356
Further Details:      
 
Domain Number 4 Region: 1609-1812
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.8e-33
Family Laminin G-like module 0.00057
Further Details:      
 
Domain Number 5 Region: 468-535
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 2.36e-17
Family Ovomucoid domain III-like 0.0072
Further Details:      
 
Domain Number 6 Region: 551-600
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000901
Family Ovomucoid domain III-like 0.0057
Further Details:      
 
Domain Number 7 Region: 901-970
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000101
Family Ovomucoid domain III-like 0.0079
Further Details:      
 
Domain Number 8 Region: 172-242
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000103
Family Ovomucoid domain III-like 0.0043
Further Details:      
 
Domain Number 9 Region: 1147-1225
Classification Level Classification E-value
Superfamily SEA domain 0.000000000000112
Family SEA domain 0.0031
Further Details:      
 
Domain Number 10 Region: 699-750
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000107
Family Ovomucoid domain III-like 0.0042
Further Details:      
 
Domain Number 11 Region: 618-665
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000236
Family Ovomucoid domain III-like 0.011
Further Details:      
 
Domain Number 12 Region: 413-462
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000222
Family Ovomucoid domain III-like 0.0051
Further Details:      
 
Domain Number 13 Region: 793-836
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000024
Family Laminin-type module 0.0056
Further Details:      
 
Domain Number 14 Region: 341-389
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000025
Family Ovomucoid domain III-like 0.0098
Further Details:      
 
Domain Number 15 Region: 248-318
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000568
Family Ovomucoid domain III-like 0.006
Further Details:      
 
Domain Number 16 Region: 847-884
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000279
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 17 Region: 1551-1586
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000301
Family EGF-type module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000368678   Gene: ENSG00000188157   Transcript: ENST00000379370
Sequence length 2045
Comment pep:known chromosome:GRCh38:1:1020123:1056116:1 gene:ENSG00000188157 transcript:ENST00000379370 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGRSHPGPLRPLLPLLVVAACVLPGAGGTCPERALERREEEANVVLTGTVEEILNVDPV
QHTYSCKVRVWRYLKGKDLVARESLLDGGNKVVISGFGDPLICDNQVSTGDTRIFFVNPA
PPYLWPAHKNELMLNSSLMRITLRNLEEVEFCVEDKPGTHFTPVPPTPPDACRGMLCGFG
AVCEPNAEGPGRASCVCKKSPCPSVVAPVCGSDASTYSNECELQRAQCSQQRRIRLLSRG
PCGSRDPCSNVTCSFGSTCARSADGLTASCLCPATCRGAPEGTVCGSDGADYPGECQLLR
RACARQENVFKKFDGPCDPCQGALPDPSRSCRVNPRTRRPEMLLRPESCPARQAPVCGDD
GVTYENDCVMGRSGAARGLLLQKVRSGQCQGRDQCPEPCRFNAVCLSRRGRPRCSCDRVT
CDGAYRPVCAQDGRTYDSDCWRQQAECRQQRAIPSKHQGPCDQAPSPCLGVQCAFGATCA
VKNGQAACECLQACSSLYDPVCGSDGVTYGSACELEATACTLGREIQVARKGPCDRCGQC
RFGALCEAETGRCVCPSECVALAQPVCGSDGHTYPSECMLHVHACTHQISLHVASAGPCE
TCGDAVCAFGAVCSAGQCVCPRCEHPPPGPVCGSDGVTYGSACELREAACLQQTQIEEAR
AGPCEQAECGSGGSGSGEDGDCEQELCRQRGGIWDEDSEDGPCVCDFSCQSVPGSPVCGS
DGVTYSTECELKKARCESQRGLYVAAQGACRGPTFAPLPPVAPLHCAQTPYGCCQDNITA
ARGVGLAGCPSACQCNPHGSYGGTCDPATGQCSCRPGVGGLRCDRCEPGFWNFRGIVTDG
RSGCTPCSCDPQGAVRDDCEQMTGLCSCKPGVAGPKCGQCPDGRALGPAGCEADASAPAT
CAEMRCEFGARCVEESGSAHCVCPMLTCPEANATKVCGSDGVTYGNECQLKTIACRQGLQ
ISIQSLGPCQEAVAPSTHPTSASVTVTTPGLLLSQALPAPPGALPLAPSSTAHSQTTPPP
SSRPRTTASVPRTTVWPVLTVPPTAPSPAPSLVASAFGESGSTDGSSDEELSGDQEASGG
GSGGLEPLEGSSVATPGPPVERASCYNSALGCCSDGKTPSLDAEGSNCPATKVFQGVLEL
EGVEGQELFYTPEMADPKSELFGETARSIESTLDDLFRNSDVKKDFRSVRLRDLGPGKSV
RAIVDVHFDPTTAFRAPDVARALLRQIQVSRRRSLGVRRPLQEHVRFMDFDWFPAFITGA
TSGAIAAGATARATTASRLPSSAVTPRAPHPSHTSQPVAKTTAAPTTRRPPTTAPSRVPG
RRPPAPQQPPKPCDSQPCFHGGTCQDWALGGGFTCSCPAGRGGAVCEKVLGAPVPAFEGR
SFLAFPTLRAYHTLRLALEFRALEPQGLLLYNGNARGKDFLALALLDGRVQLRFDTGSGP
AVLTSAVPVEPGQWHRLELSRHWRRGTLSVDGETPVLGESPSGTDGLNLDTDLFVGGVPE
DQAAVALERTFVGAGLRGCIRLLDVNNQRLELGIGPGAATRGSGVGECGDHPCLPNPCHG
GAPCQNLEAGRFHCQCPPGRVGPTCADEKSPCQPNPCHGAAPCRVLPEGGAQCECPLGRE
GTFCQTASGQDGSGPFLADFNGFSHLELRGLHTFARDLGEKMALEVVFLARGPSGLLLYN
GQKTDGKGDFVSLALRDRRLEFRYDLGKGAAVIRSREPVTLGAWTRVSLERNGRKGALRV
GDGPRVLGESPVPHTVLNLKEPLYVGGAPDFSKLARAAAVSSGFDGAIQLVSLGGRQLLT
PEHVLRQVDVTSFAGHPCTRASGHPCLNGASCVPREAAYVCLCPGGFSGPHCEKGLVEKS
AGDVDTLAFDGRTFVEYLNAVTESEKALQSNHFELSLRTEATQGLVLWSGKATERADYVA
LAIVDGHLQLSYNLGSQPVVLRSTVPVNTNRWLRVVAHREQREGSLQVGNEAPVTGSSPL
GATQLDTDGALWLGGLPELPVGPALPKAYGTGFVGCLRDVVVGRHPLHLLEDAVTKPELR
PCPTP
Download sequence
Identical sequences ENSP00000368678 9606.ENSP00000368678 ENSP00000368678 gi|54873613|ref|NP_940978.2| NP_940978.2.87134 NP_940978.2.92137 ENSP00000368678

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]