SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000369862 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000369862
Domain Number 1 Region: 524-743
Classification Level Classification E-value
Superfamily Bet v1-like 3.85e-40
Family STAR domain 0.0055
Further Details:      
 
Domain Number 2 Region: 83-243
Classification Level Classification E-value
Superfamily PH domain-like 1.79e-27
Family Pleckstrin-homology domain (PH domain) 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000369862   Gene: ENSG00000113163   Transcript: ENST00000380494
Sequence length 752
Comment pep:known chromosome:GRCh38:5:75371103:75512138:-1 gene:ENSG00000113163 transcript:ENST00000380494 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQHSCIPTPPSPFSAPPAFLPVVTRESRRGLSSGGSAGRNAGVTATAAAADGWKGRLPSP
LVLLPRSARCQARRRRGGRTSSLLLLPPTPERALFASPSPDPSPRGLGASSGAAEGAGAG
LLLGCRASMSDNQSWNSSGSEEDPETESGPPVERCGVLSKWTNYIHGWQDRWVVLKNNAL
SYYKSEDETEYGCRGSICLSKAVITPHDFDECRFDISVNDSVWYLRAQDPDHRQQWIDAI
EQHKTESGYGSESSLRRHGSMVSLVSGASGYSATSTSSFKKGHSLREKLAEMETFRDILC
RQVDTLQKYFDACADAVSKDELQRDKVVEDDEDDFPTTRSDGDFLHSTNGNKEKLFPHVT
PKGINGIDFKGEAITFKATTAGILATLSHCIELMVKREDSWQKRLDKETEKKRRTEEAYK
NAMTELKKKSHFGGPDYEEGPNSLINEEEFFDAVEAALDRQDKIEEQSQSEKVRLHWPTS
LPSGDAFSSVGTHRFVQKPYSRSSSMSSIDLVSASDDVHRFSSQVEEMVQNHMTYSLQDV
GGDANWQLVVEEGEMKVYRREVEENGIVLDPLKATHAVKGVTGHEVCNYFWNVDVRNDWE
TTIENFHVVETLADNAIIIYQTHKRVWPASQRDVLYLSVIRKIPALTENDPETWIVCNFS
VDHDSAPLNNRCVRAKINVAMICQTLVSPPEGNQEISRDNILCKITYVANVNPGGWAPAS
VLRAVAKREYPKFLKRFTSYVQEKTAGKPILF
Download sequence
Identical sequences H2QR36
gi|194294543|ref|NP_001123577.1| ENSPTRP00000029108 ENSP00000350046 9598.ENSPTRP00000029108 9606.ENSP00000369862 NP_001123577.1.87134 NP_001123577.1.92137 XP_003810502.1.60992 XP_526893.2.37143 ENSP00000369862 ENSP00000369862 ENSPTRP00000029108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]