SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000371311 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000371311
Domain Number 1 Region: 13-54
Classification Level Classification E-value
Superfamily UBA-like 0.0000000391
Family TAP-C domain-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000371311   Gene: ENSG00000163960   Transcript: ENST00000381887
Sequence length 125
Comment pep:novel chromosome:GRCh38:3:196391838:196432397:-1 gene:ENSG00000163960 transcript:ENST00000381887 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XAAHGGSAASSALKGLIQQFTTITGASESVGKHMLEACNNNLEMAVTMFLDGGGIAEEPS
TSSASVSTVRPHTEEEVRAPIPQKQEILVEPEPLFGVRQEQELRNGGAIDKKLTTLADLF
RPPID
Download sequence
Identical sequences H7BYF4
ENSP00000371311 ENSP00000371311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]