SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000371528 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000371528
Domain Number 1 Region: 32-68
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000000275
Family LDL receptor-like module 0.00072
Further Details:      
 
Domain Number 2 Region: 107-147
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000000327
Family LDL receptor-like module 0.0007
Further Details:      
 
Domain Number 3 Region: 66-106
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000236
Family LDL receptor-like module 0.00066
Further Details:      
 
Domain Number 4 Region: 146-173
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000589
Family LDL receptor-like module 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000371528   Gene: ENSG00000147852   Transcript: ENST00000382096
Sequence length 173
Comment pep:putative chromosome:GRCh38:9:2621975:2643355:1 gene:ENSG00000147852 transcript:ENST00000382096 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTSALWALWLLLALCWAPRESGATGTGRKAKCEPSQFQCTNGRCITLLWKCDGDEDCVD
GSDEKNCVKKTCAESDFVCNNGQCVPSRWKCDGDPDCEDGSDESPEQCRNITCSPDEFTC
SSGRCISRNFVCNGQDDCSDGSDELDCAPPTCGAHEFQCSTSSCIPISWVCDD
Download sequence
Identical sequences A0A2J8JGX0 Q5VVF8
ENSP00000371528 ENSP00000371528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]