SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000372437 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000372437
Domain Number 1 Region: 392-521
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.35e-41
Family PLC-like (P variant) 0.0014
Further Details:      
 
Domain Number 2 Region: 216-380
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.36e-39
Family Dual specificity phosphatase-like 0.0000109
Further Details:      
 
Domain Number 3 Region: 74-210
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000439
Family Voltage-gated potassium channels 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000372437   Gene: ENSG00000132958   Transcript: ENST00000382977
Sequence length 522
Comment pep:known chromosome:GRCh38:13:19422883:19493615:-1 gene:ENSG00000132958 transcript:ENST00000382977 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNTSPQTNEFKGTTEEAPAKESPHTSEFKGAALVSPISKSMLERLSKFEVEDAENVASYD
SKIKKIVHSIVSSFAFGIFGVFLVLLDVTLLLADLIFTDSKLYIPLEYRSISLAIGLFFL
MDVLLRVFVEGRQQYFSDLFNILDTAIIVIPLLVDVIYIFFDIKLLRNIPRWTHLVRLLR
LIILIRIFHLLHQKRQLEKLMRRLVSENKRRYTRDGFDLDLTYVTERIIAMSFPSSGRQS
FYRNPIEEVVRFLDKKHRNHYRVYNLCSERAYDPKHFHNRVSRIMIDDHNVPTLHEMVVF
TKEVNEWMAQDLENIVAIHCKGGKGRTGTMVCALLIASEIFLTAEESLYYFGERRTNKTH
SNKFQGVETPSQNRYVGYFAQVKHLYNWNLPPRRILFIKRFIIYSIRGDVCDLKVQVVME
KKVVFSSTSLGNCSILHDIETDKILINVYDGPPLYDDVKVQFFSSNLPKYYDNCPFFFWF
NTSFIQNNRLCLPRNELDNPHKQKAWKIYPPEFAVEILFGEK
Download sequence
Identical sequences ENSP00000372437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]