SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000374049 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000374049
Domain Number 1 Region: 959-1132
Classification Level Classification E-value
Superfamily vWA-like 6.52e-20
Family Integrin A (or I) domain 0.014
Further Details:      
 
Domain Number 2 Region: 507-668
Classification Level Classification E-value
Superfamily vWA-like 0.0000000000000504
Family RoRNP C-terminal domain-like 0.092
Further Details:      
 
Domain Number 3 Region: 167-328
Classification Level Classification E-value
Superfamily vWA-like 0.000000389
Family Integrin A (or I) domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000374049   Gene: ENSG00000175267   Transcript: ENST00000389398
Sequence length 1184
Comment pep:known chromosome:GRCh38:16:22092542:22156966:1 gene:ENSG00000175267 transcript:ENST00000389398 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKYRKISIGCFAMATQTSHVFHGQENMFLENHCIRRNTGRDSKKPLKQKNMNGLGQNSD
NGLLVTHVNQTQDLLRLQGSETQSSDWEDSEDWLSAHSLKCQKLTLADLISQGTEVLEEG
TNVVQKICFSTQIIRHFESKLSDTIEVYQERIQWLTENSKKAFGLIKGARVSILIDVSAI
SSGPQKEEFQKDLMSLIDEQLSHKEKLFVLSFGTNAGSLWPDPMEVSASTLQELKLWVKT
LQPDGGSNLLQALKKIFTLKGLDSLVAIMRSCPDQPSEILSDYIQQSTMGRDLIIHFITY
RCDDQMPPAVLKNLAEAVRGYYHCYSPKMEHYTSRDMDELLAEIQKAQSLLSHVQALQHS
SPCEALTCTMEEISTEITNGPLISLLPKPPKHDAPLTIEFPNLDKTSAEWLKVNGLKAKK
LSLYQVLAPNAFSPVEEFVPILQKTVSSTIHEKAMIQFEWHDGTVKNIHVDPPFLYKYQQ
QLSRAMRMYERRIEWLSLASRRIWGTVCEKRVVVLLDISATNSMYIIHIQHSLRLLLEEQ
LSNKDCFNLIAFGSTIESWRPEMVPVSHNNLQSAWRWALNLRCRGSRNVLSALRKAVEVD
FKDKDKHQSQGIYLFTGGIPDQDMPTLSAYMAEACGGCDLQLNVCLFYVGEPKMDTTPPA
RYASHTDTAAAYKEVTRAAGGRFHWFGDTGIYESDDINSIMSEMEKALNYSQKCAFLMAS
LKNHSGKVLGSSALPKEKPKTLQLRSQPKKLCPPRPTVPLGARMSIKDDPDREKSPPLKS
LKWRPLSSRVGISPAAAQPTKEGMMELRRKTKSREAETSLLLFYTEKGNDVGSVYKKYPQ
GRGLRRTSSSIDLPRKDTVCSSQEWVAKYGLKKLKLEISRCMGPNCTHQKSGQRSASAKH
CSIFPSVEIHGVVRHIQWTPREMEVYIRHLEKVLRRYVQRLQWLLSGSRRLFGTVLESKV
CILLDTSGSMGPYLQQVKTELVLLIWEQLRKCCDSFNLLSFAESFQSWQDTLVETTDAAC
HEAMQWVTHLQAQGSTSILQALLKAFSFHDLEGLYLLTDGKPDTSCSLVLNEVQKLREKR
DVKVHTISLNCSDRAAVEFLRKLASFTGGRYHCPVGEDTLSKIHSLLTKGFINEKDPTLP
PFEGDDLRILAQEITKARSFLWQAQSFRSQLQKKNDAEPKVTLS
Download sequence
Identical sequences A6NCI4
NP_775886.3.87134 NP_775886.3.92137 ENSP00000299840 ENSP00000374049 gi|218505703|ref|NP_775886.3| ENSP00000374049 9606.ENSP00000374049

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]