SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000375818 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000375818
Domain Number 1 Region: 504-561
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.52e-27
Family Classic zinc finger, C2H2 0.0028
Further Details:      
 
Domain Number 2 Region: 336-393
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.33e-26
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 3 Region: 392-449
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.6e-26
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 4 Region: 560-617
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.09e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 5 Region: 448-505
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.28e-25
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 6 Region: 604-664
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.14e-20
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 7 Region: 42-99
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000327
Family KRAB domain (Kruppel-associated box) 0.0054
Further Details:      
 
Domain Number 8 Region: 306-350
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000023
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 9 Region: 256-308
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000398
Family Classic zinc finger, C2H2 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000375818   Gene: ENSG00000167384   Transcript: ENST00000391956
Sequence length 667
Comment pep:novel chromosome:GRCh38:19:44475637:44500520:-1 gene:ENSG00000167384 transcript:ENST00000391956 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRACAGSTREAGSGAQDLSTLLCLEESMEEQDEKPPEPPKVCAQEGVNFKIVTVDFTREE
QGTCNPAQRTLDRDVILENHRDLVSWDLATAVGKKDSTSKQRIFDEEPANGVKIERFTRD
DPWLSSCEEVDDCKDQLEKQQEKQEILLQEVAFTQRKAVIHERVCKSDETGEKSGLNSSL
FSSPVIPIRNHFHKHVSHAKKWHLNAAVNSHQKINENETLYENNECGKPPQSIHLIQFTR
TQTKDKSYGFSDRIQSFCHGTPLHIHEKIHGGGKTFDFKECGQVLNPKISHNEQQRIPFE
ESQYKCSETSHSSSLTQNMRNNSEEKPFECNQCGKSFSWSSHLVAHQRTHTGEKPYECSE
CGKSFSRSSHLVSHQRTHTGEKPYRCNQCGKSFSQSYVLVVHQRTHTGEKPYECNQCGKS
FRQSYKLIAHQRTHTGEKPYECNQCGKSFIQSYKLIAHQRIHTGEKPYECNQCGKSFSQS
YKLVAHQRTHTGEKPFECNQCGKSFSWSSQLVAHQRTHTGEKPYECSECGKSFNRSSHLV
MHQRIHTGEKPYECNQCGKSFSQSYVLVVHQRTHTGEKPYECSQCGKSFRQSSCLTQHQR
THTGEKPFECNQCGKTFSLSARLIVHQRTHTGEKPFTCIQCGKAFINSYKLIRHQATHTE
EKLYECN
Download sequence
Identical sequences G5E9B8
ENSP00000375818 NP_001265437.2.87134 NP_001265437.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]