SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000376065 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000376065
Domain Number 1 Region: 373-430
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.48e-23
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 2 Region: 317-374
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.58e-22
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 3 Region: 485-542
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.67e-21
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 4 Region: 531-583
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.78e-20
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 5 Region: 46-104
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.31e-19
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 6 Region: 279-331
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.88e-19
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 7 Region: 429-486
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.59e-18
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000376065   Gene: ENSG00000197841   Transcript: ENST00000392232
Sequence length 615
Comment pep:known chromosome:GRCh38:19:34734156:34742872:1 gene:ENSG00000197841 transcript:ENST00000392232 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQLQYPEGYLAPNRCLVSNCGVNKMSNDELVGQNHGMEGEACIGGDVTFNDVAIDFTHE
EWGWLSSAQRDLYKDVMVQNYENLVSVAGLSVTKPYVITLLEDGKEPWMMEKKLSKGMIP
DWESRWENKELSTKKDNYDEDSPQTVIIEKVVKQSYEFSNSKKNLEYIEKLEGKHGSQVD
HFRPAILTSRESPTADSVYKYNIFRSTFHSKSTLSEPQKISAEGNSHKYDILKKNLPKKS
VIKNEKVNGGKKLLNSNKSGAAFSQGKSLTLPQTCNREKIYTCSECGKAFGKQSILNRHW
RIHTGEKPYECRECGKTFSHGSSLTRHLISHSGEKPYKCIECGKAFSHVSSLTNHQSTHT
GEKPYECMNCGKSFSRVSHLIEHLRIHTQEKLYECRICGKAFIHRSSLIHHQKIHTGEKP
YECRECGKAFCCSSHLTRHQRIHTMEKQYECNKCLKVFSSLSFLVQHQSIHTEEKPFECQ
KCRKSFNQLESLNMHLRNHIRLKPYECSICGKAFSHRSSLLQHHRIHTGEKPYECIKCGK
TFSCSSNLTVHQRIHTGEKPYKCNECGKAFSKGSNLTAHQRVHNGEKPNSVVSVEKPLDY
MNHYTCEKSYRRETV
Download sequence
Identical sequences F8W889
ENSP00000376065 ENSP00000376065 ENSP00000376065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]