SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000377087 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000377087
Domain Number 1 Region: 1-167
Classification Level Classification E-value
Superfamily RUN domain-like 5.23e-51
Family RUN domain 0.000000233
Further Details:      
 
Domain Number 2 Region: 486-596
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 4.27e-21
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSP00000377087
Domain Number - Region: 192-255
Classification Level Classification E-value
Superfamily Prefoldin 0.00288
Family Prefoldin 0.0099
Further Details:      
 
Domain Number - Region: 341-527
Classification Level Classification E-value
Superfamily Tropomyosin 0.0262
Family Tropomyosin 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000377087   Gene: ENSG00000176783   Transcript: ENST00000393438
Sequence length 600
Comment pep:known chromosome:GRCh38:5:179559692:179610012:1 gene:ENSG00000176783 transcript:ENST00000393438 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMEERANLMHMMKLSIKVLLQSALSLGRSLDADHAPLQQFFVVMEHCLKHGLKVKKSFIG
QNKSFFGPLELVEKLCPEASDIATSVRNLPELKTAVGRGRAWLYLALMQKKLADYLKVLI
DNKHLLSEFYEPEALMMEEEGMVIVGLLVGLNVLDANLCLKGEDLDSQVGVIDFSLYLKD
VQDLDGGKEHERITDVLDQKNYVEELNRHLSCTVGDLQTKIDGLEKTNSKLQEELSAATD
RICSLQEEQQQLREQNELIRERSEKSVEITKQDTKVELETYKQTRQGLDEMYSDVWKQLK
EEKKVRLELEKELELQIGMKTEMEIAMKLLEKDTHEKQDTLVALRQQLEEVKAINLQMFH
KAQNAESSLQQKNEAITSFEGKTNQVMSSMKQMEERLQHSERARQGAEERSHKLQQELGG
RIGALQLQLSQLHEQCSSLEKELKSEKEQRQALQRELQHEKDTSSLLRMELQQVEGLKKE
LRELQDEKAELQKICEEQEQALQEMGLHLSQSKLKMEDIKEVNQALKGHAWLKDDEATHC
RQCEKEFSISRRKHHCRNCGHIFCNTCSSNELALPSYPKPVRVCDSCHTLLLQRCSSTAS
Download sequence
Identical sequences NP_001035541.1.87134 NP_001035541.1.92137 NP_001035542.1.87134 NP_001035542.1.92137 gi|94721330|ref|NP_001035542.1| gi|94721332|ref|NP_001035541.1| ENSP00000377087 ENSP00000390025 ENSP00000377087 ENSP00000390025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]