SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000380057 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000380057
Domain Number 1 Region: 30-120
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.93e-40
Family SCAN domain 0.0000449
Further Details:      
 
Domain Number 2 Region: 529-586
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.8e-25
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 3 Region: 585-642
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.03e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 4 Region: 627-679
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.62e-17
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 5 Region: 206-248
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000314
Family KRAB domain (Kruppel-associated box) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000380057   Gene: ENSG00000140987   Transcript: ENST00000396846
Sequence length 697
Comment pep:known chromosome:GRCh38:16:3382081:3401065:-1 gene:ENSG00000140987 transcript:ENST00000396846 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMAAVKSTEAHPSSNKDPTQGQKSALQGNSPDSEASRQRFRQFCYQEVTGPHEAFSKLWE
LCCQWLRPKTHSKEEILELLVLEQFLTILPEEIQTWVREQHPENGEEAVALVEDVQRAPG
QQVLDSEKDLKVLMKEMAPLGATRESLRSQWKQEVQPEEPTFKGSQSSHQRPGEQSEAWL
APQAPRNLPQNTGLHDQETGAVVWTAGSQGPAMRDNRAVSLCQQEWMCPGPAQRALYRGA
TQRKDSHVSLATGVPWGYEETKTLLAILSSSQFYGKLQTCQQNSQIYRAMAEGLWEQGFL
RTPEQCRTKFKSLQLSYRKVRRGRVPEPCIFYEEMNALSGSWASAPPMASDAVPGQEGSD
IEAGELNHQNGEPTEVEDGTVDGADRDEKDFRNPGQEVRKLDLPVLFPNRLGFEFKNEIK
KENLKWDDSEEVEINKALQRKSRGVYWHSELQKGLESEPTSRRQCRNSPGESEEKTPSQE
KMSHQSFCARDKACTHILCGKNCSQSVHSPHKPALKLEKVSQCPECGKTFSRSSYLVRHQ
RIHTGEKPHKCSECGKGFSERSNLTAHLRTHTGERPYQCGQCGKSFNQSSSLIVHQRTHT
GEKPYQCIVCGKRFNNSSQFSAHRRIHTGESPYKCAVCGKIFNNSSHFSAHRKTHTGEKP
YRCSHCERGFTKNSALTRHQTVHMKAVLSSQEGRDAL
Download sequence
Identical sequences Q9NX65
ENSP00000380057 ENSP00000380057 ENSP00000380061 NP_001271456.1.87134 NP_001271456.1.92137 XP_011520857.1.92137 XP_016878860.1.92137 ENSP00000380057 ENSP00000380061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]