SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000382684 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000382684
Domain Number - Region: 49-100
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0572
Family Cytochrome c3-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000382684   Gene: ENSG00000170262   Transcript: ENST00000399784
Sequence length 172
Comment pep:known chromosome:GRCh38:21:32291813:32312290:1 gene:ENSG00000170262 transcript:ENST00000399784 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANGTNASAPYYSYEYYLDYLDLIPVDEKKLKAHKHSIVIAFWVSLAAFVVLLFLILLYM
SWSASPQMRNSPKHHQTCPWSHGLNLHLCIQKCLPCHREPLATSQAQASSVEPGSRTGPD
QPLRQESSSTLPLGGFQTHPTLLWELTLNGGPLVRSKPSEPPPGDRTSQLQS
Download sequence
Identical sequences Q8TCY5
9606.ENSP00000306697 gi|30520312|ref|NP_848932.1| ENSP00000306697 ENSP00000382684 ENSP00000306697 ENSP00000306697 ENSP00000382684 NP_848932.1.87134 NP_848932.1.92137 XP_006724091.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]