SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000383339 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000383339
Domain Number 1 Region: 603-904
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.35e-72
Family Protein kinases, catalytic subunit 0.00000119
Further Details:      
 
Domain Number 2 Region: 29-187
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 8.79e-42
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000383339   Gene: ENSG00000215522   Transcript: ENST00000400492
Sequence length 913
Comment pep:known chromosome:GRCh38:CHR_HSCHR6_MHC_QBL_CTG1:30870603:30889733:1 gene:ENSG00000215522 transcript:ENST00000400492 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPEALSSLLLLLLVASGDADMKGHFDPAKCRYALGMQDRTIPDSDISASSSWSDSTAAR
HSRLESSDGDGAWCPAGSVFPKEEEYLQVDLQRLHLVALVGTQGRHAGGLGKEFSRSYRL
RYSRDGRRWMGWKDRWGQEVISGNEDPEGVVLKDLGPPMVARLVRFYPRADRVMSVCLRV
ELYGCLWRDGLLSYTAPVGQTMYLSEAVYLNDSTYDGHTVGGLQYGGLGQLADGVVGLDD
FRKSQELRVWPGYDYVGWSNHSFSSGYVEMEFEFDRLRAFQAMQVHCNNMHTLGARLPGG
VECRFRRGPAMAWEGEPMRHNLGGNLGDPRARAVSVPLGGRVARFLQCRFLFAGPWLLFS
EISFISDVVNNSSPALGGTFPPAPWWPPGPPPTNFSSLELEPRGQQPVAKAEGSPTAILI
GCLVAIILLLLLIIALMLWRLHWRRLLSKAERRVLEEELTVHLSVPGDTILINNRPGPRE
PPPYQEPRPRGNPPHSAPCVPNGSALLLSNPAYRLLLATYARPPRGPGPPTPAWAKPTNT
QAYSGDYMEPEKPGAPLLPPPPQNSVPHYAEADIVTLQGVTGGNTYAVPALPPGAVGDGP
PRVDFPRSRLRFKEKLGEGQFGEVHLCEVDSPQDLVSLDFPLNVRKGHPLLVAVKILRPD
ATKNARNDFLKEVKIMSRLKDPNIIRLLGVCVQDDPLCMITDYMENGDLNQFLSAHQLED
KAAEGAPGDGQAAQGPTISYPMLLHVAAQIASGMRYLATLNFVHRDLATRNCLVGENFTI
KIADFGMSRNLYAGDYYRVQGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLC
RAQPFGQLTDEQVIENAGEFFRDQGRQVYLSRPPACPQGLYELMLRCWSRESEQRPPFSQ
LHRFLAEDALNTV
Download sequence
Identical sequences A0A024RCL1 K7DC42 Q08345
gi|83977450|ref|NP_054699.2| ENSP00000318217 ENSP00000365752 ENSP00000372868 ENSP00000383265 ENSP00000383338 ENSP00000383339 ENSP00000391805 ENSP00000397769 ENSP00000401397 ENSP00000405039 ENSP00000414285 9598.ENSPTRP00000030610 9606.ENSP00000401397 NP_001284583.1.87134 NP_001284583.1.92137 NP_054699.2.87134 NP_054699.2.92137 XP_003807390.1.60992 XP_008957703.1.60992 XP_008957704.1.60992 XP_008957705.1.60992 XP_008957706.1.60992 XP_008957707.1.60992 XP_009449103.1.37143 XP_014200776.1.60992 XP_014200777.1.60992 XP_016810135.1.37143 ENSP00000318217 ENSP00000365752 ENSP00000372868 ENSP00000383265 ENSP00000383338 ENSP00000383339 ENSP00000391805 ENSP00000397769 ENSP00000401397 ENSP00000405039 ENSP00000414285 ENSP00000448377 ENSP00000449190 ENSP00000449255 ENSP00000449611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]