SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000383411 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000383411
Domain Number 1 Region: 237-303
Classification Level Classification E-value
Superfamily SAM/Pointed domain 9.65e-18
Family SAM (sterile alpha motif) domain 0.0000992
Further Details:      
 
Domain Number 2 Region: 158-226
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000801
Family SH3-domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000383411   Gene: ENSG00000155307   Transcript: ENST00000400566
Sequence length 373
Comment pep:known chromosome:GRCh38:21:14485228:14546343:-1 gene:ENSG00000155307 transcript:ENST00000400566 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKRKPSNVSEKEKHQKPKRSSSFGNFDRFRNNSLSKPDDSTEAHEGDPTNGSGEQSKTS
NNGGGLGKKMRAISWTMKKKVGKKYIKALSEEKDEEDGENAHPYRNSDPVIGTHTEKVSL
KASDSMDSLYSGQSSSSGITSCSDGTSNRDSFRLDDDGPYSGPFCGRARVHTDFTPSPYD
TDSLKIKKGDIIDIICKTPMGMWTGMLNNKVGNFKFIYVDVISEEEAAPKKIKANRRSNS
KKSKTLQEFLERIHLQEYTSTLLLNGYETLEDLKDIKESHLIELNIENPDDRRRLLSAAE
NFLEEEIIQEQENEPEPLSLSSDISLNKSQLDDCPRDSGCYISSGNSDNGKEDLESENLS
DMVHKIIITEPSD
Download sequence
Identical sequences Q9NSI8
9606.ENSP00000383411 ENSP00000383411 gi|48762709|ref|NP_071419.3| ENSP00000383411 NP_071419.3.87134 NP_071419.3.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]