SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000383438 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000383438
Domain Number 1 Region: 55-163
Classification Level Classification E-value
Superfamily PDB 1.21e-27
Family PDB 0.0012
Further Details:      
 
Domain Number 2 Region: 91-170
Classification Level Classification E-value
Superfamily Ribosomal protein S18 2.93e-22
Family Ribosomal protein S18 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000383438   Gene: ENSG00000203624   Transcript: ENST00000327800
Sequence length 258
Comment pep:known chromosome:GRCh38:CHR_HSCHR6_MHC_QBL_CTG1:30607204:30615890:1 gene:ENSG00000203624 transcript:ENST00000327800 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASVLNTVLRRLPMLSLFRGSHRVQVPLQTLCTKAPSEEDSLSSVPISPYKDEPWKYLE
SEEYQERYGSRPVWADYRRNHKGGVPPQRTRKTCIRRNKVVGNPCPICRDHKLHVDFRNV
KLLEQFVCAHTGIIFYAPYTGVCVKQHKRLTQAIQKARDHGLLIYHIPQVEPRDLDFSTS
HGAVSATPPAPTLVSGDPWYPWYNWKQPPERELSRLRRLYQGHLQEESGPPPESMPKMPP
RTPAEASSTGQTGPQSAL
Download sequence
Identical sequences B0S7P4 Q9Y676
3j9m_AO 9606.ENSP00000259873 9606.ENSP00000383438 9606.ENSP00000397790 9606.ENSP00000398494 9606.ENSP00000402718 9606.ENSP00000414972 9606.ENSP00000415703 NP_054765.1.87134 NP_054765.1.92137 ENSP00000259873 ENSP00000383437 ENSP00000390930 ENSP00000397340 ENSP00000397472 ENSP00000397790 ENSP00000398494 gi|7662645|ref|NP_054765.1| ENSP00000259873 ENSP00000383438 ENSP00000397790 ENSP00000398494 ENSP00000402718 ENSP00000414972 ENSP00000415703 ENSP00000259873 ENSP00000383438 ENSP00000397790 ENSP00000398494 ENSP00000402718 ENSP00000414972 ENSP00000415703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]