SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000384726 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000384726
Domain Number 1 Region: 295-334
Classification Level Classification E-value
Superfamily WW domain 0.00000578
Family WW domain 0.0053
Further Details:      
 
Domain Number 2 Region: 584-653
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.0000554
Family Double-stranded RNA-binding domain (dsRBD) 0.013
Further Details:      
 
Weak hits

Sequence:  ENSP00000384726
Domain Number - Region: 503-534
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.0444
Family Double-stranded RNA-binding domain (dsRBD) 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000384726   Gene: ENSG00000128191   Transcript: ENST00000407755
Sequence length 740
Comment pep:known chromosome:GRCh38:22:20085822:20111872:1 gene:ENSG00000128191 transcript:ENST00000407755 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METDESPSPLPCGPAGEAVMESRARPFQALPREQSPPPPLQTSSGAEVMDVGSGGDGQSE
LPAEDPFNFYGASLLSKGSFSKGRLLIDPNCSGHSPRTARHAPAVRKFSPDLKLLKDVKI
SVSFTESCRSKDRKVLYTGAERDVRAECGLLLSPVSGDVHACPFGGSVGDGVGIGGESAD
KKDEENELDQEKRVEYAVLDELEDFTDNLELDEEGAGGFTAKAIVQRDRVDEEALNFPYE
DDFDNDVDALLEEGLCAPKKRRTEEKYGGDSDHPSDGETSVQPMMTKIKTVLKSRGRPPT
EPLPDGWIMTFHNSGVPVYLHRESRVVTWSRPYFLGTGSIRKHDPPLSSIPCLHYKKMKD
NEEREQSSDLTPSGDVSPVKPLSRSAELEFPLDEPDSMGADPGPPDEKDPLGAEAAPGAL
GQVKAKVEVCKDESVDLEEFRSYLEKRFDFEQVTVKKFRTWAERRQFNREMKRKQAESER
PILPANQKLITLSVQDAPTKKEFVINPNGKSEVCILHEYMQRVLKVRPVYNFFECARATL
EILIPDFVKQTSEEKPKDSEELEYFNHISIEDSRVYELTSKAGLLSPYQILHECLKRNHG
MGDTSIKFEVVPGKNQKSEYVMACGKHTVRGWCKNKRVGKQLASQKILQLLHPHVKNWGS
LLRMYGRESSKMVKQETSDKSVIELQQYAKKNKPNLHILSKLQEEMKRLAEEREETRKKP
KMSIVASAQPGGEPLCTVDV
Download sequence
Identical sequences A0A2I3T2G0
ENSP00000372488 ENSP00000384726 gi|298358598|ref|NP_001177255.1| ENSP00000372488 ENSP00000384726 NP_001177255.1.87134 NP_001177255.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]