SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000385636 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000385636
Domain Number 1 Region: 11-106
Classification Level Classification E-value
Superfamily Immunoglobulin 1.47e-21
Family I set domains 0.012
Further Details:      
 
Domain Number 2 Region: 127-233
Classification Level Classification E-value
Superfamily Immunoglobulin 6.21e-20
Family I set domains 0.011
Further Details:      
 
Domain Number 3 Region: 252-339
Classification Level Classification E-value
Superfamily Immunoglobulin 1.82e-19
Family I set domains 0.01
Further Details:      
 
Domain Number 4 Region: 1621-1705
Classification Level Classification E-value
Superfamily Immunoglobulin 8.32e-18
Family I set domains 0.059
Further Details:      
 
Domain Number 5 Region: 1354-1445
Classification Level Classification E-value
Superfamily Immunoglobulin 8.52e-18
Family I set domains 0.012
Further Details:      
 
Domain Number 6 Region: 1813-1895
Classification Level Classification E-value
Superfamily Immunoglobulin 3.56e-17
Family I set domains 0.023
Further Details:      
 
Domain Number 7 Region: 799-892
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000109
Family I set domains 0.02
Further Details:      
 
Domain Number 8 Region: 1163-1263
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000346
Family I set domains 0.026
Further Details:      
 
Domain Number 9 Region: 980-1075
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000849
Family I set domains 0.03
Further Details:      
 
Domain Number 10 Region: 890-985
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000024
Family I set domains 0.037
Further Details:      
 
Domain Number 11 Region: 1071-1157
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000319
Family I set domains 0.042
Further Details:      
 
Domain Number 12 Region: 333-428
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000971
Family I set domains 0.019
Further Details:      
 
Domain Number 13 Region: 1450-1535
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000013
Family I set domains 0.015
Further Details:      
 
Domain Number 14 Region: 720-811
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000141
Family I set domains 0.016
Further Details:      
 
Domain Number 15 Region: 1722-1808
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000036
Family I set domains 0.0045
Further Details:      
 
Domain Number 16 Region: 1259-1354
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000167
Family I set domains 0.026
Further Details:      
 
Domain Number 17 Region: 1542-1630
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000188
Family I set domains 0.0031
Further Details:      
 
Domain Number 18 Region: 515-604
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000132
Family Fibronectin type III 0.0043
Further Details:      
 
Domain Number 19 Region: 433-542
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000416
Family I set domains 0.0095
Further Details:      
 
Weak hits

Sequence:  ENSP00000385636
Domain Number - Region: 619-716
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000214
Family I set domains 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000385636   Gene: ENSG00000124006   Transcript: ENST00000404537
Sequence length 1896
Comment pep:known chromosome:GRCh38:2:219550742:219571289:-1 gene:ENSG00000124006 transcript:ENST00000404537 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKASSGDQGSPPCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSF
PADGAEHGLLLTAALPTDAGVYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPS
PGSGEGAPVFLTGPRSQWVLRGAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQ
PGRAEDGPGASLALRILAARLPDSGVYVCHARNAHGHAQAGALLQVHQPPESPPADPDEA
PAPVVEPLKCAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDG
GFVLKVLYCQAKDRGLYVCAARNSAGQTLSAVQLHVKEPRLRFTRPLQDVEGREHGIAVL
ECKVPNSRIPTAWFREDQRLLPCRKYEQIEEGTVRRLIIHRLKADDDGIYLCEMRGRVRT
VANVTVKGPILKRLPRKLDVLEGENAVLLVETLEAGVEGRWSRDGEELPVICQSSSGHMH
ALVLPGVTREDAGEVTFSLGNSRTTTLLRVKCVKHSPPGPPILAEMFKGHKNTVLLTWKP
PEPAPETPFIYRLERQEVGSEDWIQCFSIEKAGAVEVPGDCVPSEGDYRFRICTVSGHGR
SPHVVFHGSAHLVPTARLVAGLEDVQVYDGEDAVFSLDLSTIIQGTWFLNGEELKSNEPE
GQVEPGALRYRIEQKGLQHRLILHAVKHQDSGALVGFSCPGVQDSAALTIQESPVHILSP
QDRVSLTFTTSERVVLTCELSRVDFPATWYKDGQKVEESELLVVKMDGRKHRLILPEAKV
QDSGEFECRTEGVSAFFGVTVQDPPVHIVDPREHVFVHAITSECVMLACEVDREDAPVRW
YKDGQEVEESDFVVLENEGPHRRLVLPATQPSDGGEFQCVAGDECAYFTVTITDVSSWIV
YPSGKVYVAAVRLERVVLTCELCRPWAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPAV
QLEDSGEYLCEIDDESASFTVTVTEPPVRIIYPRDEVTLIAVTLECVVLMCELSREDAPV
RWYKDGLEVEESEALVLERDGPRCRLVLPAAQPEDGGEFVCDAGDDSAFFTVTVTAPPER
IVHPAARSLDLHFGAPGRVELRCEVAPAGSQVRWYKDGLEVEASDALQLGAEGPTRTLTL
PHAQPEDAGEYVCETRHEAITFNVILAEPPVQFLALETTPSPLCVAPGEPVVLSCELSRA
GAPVVWSHNGRPVQEGEGLELHAEGPRRVLCIQAAGPAHAGLYTCQSGAAPGAPSLSFTV
QVAEPPVRVVAPEAAQTRVRSTPGGDLELVVHLSGPGGPVRWYKDGERLASQGRVQLEQA
GARQVLRVQGARSGDAGEYLCDAPQDSRIFLVSVEEPLLVKLVSELTPLTVHEGDDATFR
CEVSPPDADVTWLRNGAVVTPGPQVEMAQNGSSRILTLRGCQLGDAGTVTLRAGSTATSA
RLHVRETELLFLRRLQDVRAEEGQDVCLEVETGRVGAAGAVRWVRGGQPLPHDSRLSMAQ
DGHIHRLFIHGVILADQGTYGCESHHDRTLARLSVRPRQLRVLRPLEDVTISEGGSATFQ
LELSQEGVTGEWARGGVQLYPGPKCHIHSDGHRHRLVLNGLGLADSGCVSFTADSLRCAA
RLIVREVPVTIVRGPHDLEVTEGDTATFECELSQALADVTWEKDGNALTPSPRLRLQALG
TRRLLQLRRCGPSDAGTYSCAVGTARAGPVRLTVRERTVAVLSELRSVSAREGDGATFEC
TVSEVETTGRWELGGRPLRPGARVRIRQEGKKHILVLSELRAEDAGEVRFQAGPAQSLAL
LEVEALPLQMCRHPPREKTVLVGRRAVLEVTVSRSGGHVCWLREGAELCPGDKYEMRSHG
PTHSLVIHDVRPEDQGTYCCQAGQDSTHTRLLVEGN
Download sequence
Identical sequences O75147
ENSP00000385636 gi|144226847|ref|NP_056126.1| NP_056126.1.87134 NP_056126.1.92137 ENSP00000385636 9606.ENSP00000385636 ENSP00000265317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]