SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000386380 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000386380
Domain Number 1 Region: 380-543
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 9.42e-24
Family Toll/Interleukin receptor TIR domain 0.0018
Further Details:      
 
Domain Number 2 Region: 225-328
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000107
Family I set domains 0.00000221
Further Details:      
 
Domain Number 3 Region: 137-208
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000134
Family I set domains 0.0000137
Further Details:      
 
Domain Number 4 Region: 44-106
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000115
Family I set domains 0.0000333
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000386380   Gene: ENSG00000115594   Transcript: ENST00000410023
Sequence length 569
Comment pep:known chromosome:GRCh38:2:102142786:102179874:1 gene:ENSG00000115594 transcript:ENST00000410023 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVLLRLICFIALLISSLEADKCKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKD
DSKTPVSTEQASRIHQHKEKLWFVPAKVEDSGHYYCVVRNSSYCLRIKISAKFVENEPNL
CYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQWYKDCKPLLLDNIHFSGVKDR
LIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDL
GSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISE
IESRFYKHPFTCFAKNTHGIDAAYIQLIYPVTNFQKHMIGICVTLTVIIVCSVFIYKIFK
IDIVLWYRDSCYDFLPIKASDGKTYDAYILYPKTVGEGSTSDCDIFVFKVLPEVLEKQCG
YKLFIYGRDDYVGEDIVEVINENVKKSRRLIIILVRETSGFSWLGGSSEEQIAMYNALVQ
DGIKVVLLELEKIQDYEKMPESIKFIKQKHGAIRWSGDFTQGPQSAKTRFWKNVRYHMPV
QRRSPSSKHQLLSPATKEKLQREAHVPLG
Download sequence
Identical sequences P14778
gi|4504659|ref|NP_000868.1| 9606.ENSP00000233946 NYSGRC-IgSF-IL1R1_HUMAN ENSP00000386380 ENSP00000393296 ENSP00000233946 ENSP00000386380 NP_000868.1.87134 NP_000868.1.92137 NP_001307907.1.87134 NP_001307907.1.92137 NP_001307909.1.87134 NP_001307909.1.92137 NP_001307910.1.87134 NP_001307910.1.92137 NP_001307911.1.87134 NP_001307911.1.92137 XP_005263987.1.92137 XP_005263991.1.92137 XP_011509417.1.92137 XP_011509418.1.92137 XP_011509419.1.92137 XP_011509420.1.92137 XP_016859478.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]