SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000387131 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000387131
Domain Number 1 Region: 225-328
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000702
Family I set domains 0.00000221
Further Details:      
 
Domain Number 2 Region: 137-208
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000925
Family I set domains 0.0000137
Further Details:      
 
Domain Number 3 Region: 44-106
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000811
Family I set domains 0.0000333
Further Details:      
 
Domain Number 4 Region: 380-434
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 0.0000235
Family Toll/Interleukin receptor TIR domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000387131   Gene: ENSG00000115594   Transcript: ENST00000409329
Sequence length 447
Comment pep:putative chromosome:GRCh38:2:102104569:102175817:1 gene:ENSG00000115594 transcript:ENST00000409329 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVLLRLICFIALLISSLEADKCKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKD
DSKTPVSTEQASRIHQHKEKLWFVPAKVEDSGHYYCVVRNSSYCLRIKISAKFVENEPNL
CYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQWYKDCKPLLLDNIHFSGVKDR
LIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDL
GSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISE
IESRFYKHPFTCFAKNTHGIDAAYIQLIYPVTNFQKHMIGICVTLTVIIVCSVFIYKIFK
IDIVLWYRDSCYDFLPIKASDGKTYDAYILYPKTVGEGSTSDCDIFVFKVLPEVLEKQCG
YKLFIYGRDDYVGEGMCVMEQSKGLLL
Download sequence
Identical sequences B8ZZ73
ENSP00000386478 ENSP00000387131 ENSP00000415366 ENSP00000386478 ENSP00000387131 ENSP00000415366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]