SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000387930 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000387930
Domain Number 1 Region: 221-417
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.69e-40
Family SPRY domain 0.00023
Further Details:      
 
Domain Number 2 Region: 80-150
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000306
Family RING finger domain, C3HC4 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000387930   Gene: ENSG00000230467   Transcript: ENST00000420562
Sequence length 420
Comment pep:known chromosome:GRCh38:CHR_HSCHR6_MHC_SSTO_CTG1:30060650:30066271:-1 gene:ENSG00000230467 transcript:ENST00000420562 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWWRDLTRLRLWLKREAIPGEGRKAAKVNAGVGEKGIYTASSRGGPPSARSKAVTVVAEG
AASRSWLSMDAPELGPGLVERLEQLATCPLCGGSFEDPVLLACEHSFCRACLARRWGTPP
ATGTEASPTACPCCGLPCPRRSLRSNVRLAVEVRISRELREKLAEPGARAGRRRGGRIPT
MGCLDLPGEDMRKTWRRFEVPTSKSSNSEDDLPEDYPVVKKMLHRLTADLTLDPGTAHRR
LLISADRRSVQLAPPGTPAPPDGPKRFDQLPAVLGAQGFGAGRHCWEVETADAASCRDSS
GEDADDEESHYAVGAAGESVQRKGCVRLCPAGAVWAVGGRGGRLWALTAPEPTLLGGVEP
PPRRIRVDLDWERGRVAFYDGRSLDLLYAFQAPGPLGERIFPLFCTCDPRAPLRIVPAES
Download sequence
Identical sequences A0A140T901
ENSP00000387930 ENSP00000387930 9606.ENSP00000387930 ENSP00000387930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]