SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000388025 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000388025
Domain Number 1 Region: 32-169
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000022
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 2 Region: 156-198
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000362
Family EGF-type module 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000388025   Gene: ENSG00000144152   Transcript: ENST00000441565
Sequence length 273
Comment pep:novel chromosome:GRCh38:2:112159748:112187323:1 gene:ENSG00000144152 transcript:ENST00000441565 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RFAEGIRHMKSRLAALQNSVGRVGPDALPGISECSSQPCQNGGTCVEGVNQYRCICPPGR
TGNRCQHQAQTAAPEGSVAGDSAFSRAPRCAQVERAQHCSCEAGFHLSGAAGDSVCQDVN
ECELYGQEGRPRLCMHACVNTPGSYRCTCPGGYRTLADGKSCEDVDECVGLQPVCPQGTT
CINTGGSFQCVSPECPEGSGNVSYVKTSPFQCERNPCPMDSRPCRHLPKTISFHYLSLPS
NLKTPITLFRMATASAPGRAGPNSLRFGIVGGN
Download sequence
Identical sequences H7BZ65
ENSP00000388025 ENSP00000388025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]