SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000390149 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000390149
Domain Number 1 Region: 2-91
Classification Level Classification E-value
Superfamily (Trans)glycosidases 8e-25
Family Bee venom hyaluronidase 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSP00000390149
Domain Number - Region: 154-173
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0204
Family EGF-type module 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000390149   Gene: ENSG00000114378   Transcript: ENST00000447605
Sequence length 176
Comment pep:known chromosome:GRCh38:3:50300482:50303573:-1 gene:ENSG00000114378 transcript:ENST00000447605 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYVQHRVAEAFRVAVAAGDPNLPVLPYVQIFYDTTNHFLPLDELEHSLGESAAQGAAGVV
LWVSWENTRTKESCQAIKEYMDTTLGPFILNVTSGALLCSQALCSGHGRCVRRTSHPKAL
LLLNPASFSIQLTPGGGPLSLRGALSLEDQAQMAVEFKCRCYPGWQAPWCERKSMW
Download sequence
Identical sequences NP_695017.1.87134 NP_695017.1.92137 ENSP00000390149 ENSP00000461900 gi|24497572|ref|NP_695017.1| ENSP00000390149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]