SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000391068 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000391068
Domain Number 1 Region: 298-645
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 2.88e-39
Family Hect, E3 ligase catalytic domain 0.012
Further Details:      
 
Domain Number 2 Region: 164-245
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 4.87e-29
Family PHD domain 0.00074
Further Details:      
 
Weak hits

Sequence:  ENSP00000391068
Domain Number - Region: 92-153
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00221
Family PHD domain 0.023
Further Details:      
 
Domain Number - Region: 22-60
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00288
Family PHD domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000391068   Gene: ENSG00000092140   Transcript: ENST00000438909
Sequence length 660
Comment pep:putative chromosome:GRCh38:14:30559158:30616669:1 gene:ENSG00000092140 transcript:ENST00000438909 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSGIWQRGKEEEGVYGFLIEDIRKEVNRASKLKCCVCKKNGASIGCVAPRCKRSYHFPC
GLQRECIFQFTGNFASFCWDHRPVQIITSNNYRESLPCTICLEFIEPIPSYNILRSPCCK
NAWFHRDCLQVQAINAGVFFFRCTICNNSDIFQKEMLRMGIHIPEKDASWELEENAYQEL
LQHYERCDVRRCRCKEGRDYNAPDSKWEIKRCQCCGSSGTHLACSSLRSWEQNWECLECR
GIIYNSGEFQKAKKHVLPNSNNVGITDCLLEESSPKLPRQSPGSQSKDLLRQGSKFRRNV
STLLIELGFQIKKKTKRLYINKANIWNSALDAFRNRNFNPSYAIEVAYVIENDNFGSEHP
GSKQEFLSLLMQHLENSSLFEGSLSKNLSLNSQALKENLYYEAGKMLAISLVHGGPSPGF
FSKTLFNCLVYGPENTQPILDDVSDFDVAQIIIRINTATTVADLKSIINECYNYLELIGC
LRLITTLSDKYMLVKDILGYHVIQRVHTPFESFKQGLKTLGVLEKIQAYPEAFCSILCHK
PESLSAKILSELFTVHTLPDVKALGFWNSYLQAVEDGKSTTTMEDILIFATGCSSIPPAG
FKPTPSIECLHVDFPVGNKCNNCLAIPITNTYKEFQENMDFTIRNTLRLEKEESSHYIGH
Download sequence
Identical sequences F5GX24
NP_001295026.1.87134 NP_001295026.1.92137 ENSP00000391068 ENSP00000391068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]