SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000391376 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000391376
Domain Number 1 Region: 36-123
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 4.3e-36
Family SCAN domain 0.0000526
Further Details:      
 
Domain Number 2 Region: 443-500
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.62e-22
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 3 Region: 485-537
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.65e-21
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 4 Region: 407-457
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000134
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 5 Region: 222-264
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000745
Family KRAB domain (Kruppel-associated box) 0.0037
Further Details:      
 
Weak hits

Sequence:  ENSP00000391376
Domain Number - Region: 331-351
Classification Level Classification E-value
Superfamily TTHA1013/TTHA0281-like 0.0183
Family TTHA0281-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000391376   Gene: ENSG00000154957   Transcript: ENST00000454073
Sequence length 548
Comment pep:known chromosome:GRCh38:17:11977452:11997457:-1 gene:ENSG00000154957 transcript:ENST00000454073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVDLGQALGLLPSLAKAEDSQFSESDAALQEELSSPETARQLFRQFRYQVMSGPHETLK
QLRKLCFQWLQPEVHTKEQILEILMLEQFLTILPGEIQMWVRKQCPGSGEEAVTLVESLK
GDPQRLWQWISIQVLGQDILSEKMESPSCQVGEVEPHLEVVPQELGLENSSSGPGELLSH
IVKEESDTEAELALAASQPARLEERLIRDQDLGASLLPAAPQEQWRQLDSTQKEQYWDLM
LETYGKMVSGGISHPKSDLTNSIEFGEELAGIYLHVNEKIPRPTCIGDRQENDKENLNLE
NHRDQELLHASCQASGEVPSQASLRGFFTEDEPGCFGEGENLPEALQNIQDEGTGEQLSP
QERISEKQLGQHLPNPHSGEMSTMWLEEKRETSQKGQPRAPMAQKLPTCRECGKTFYRNS
QLIFHQRTHTGETYFQCTICKKAFLRSSDFVKHQRTHTGEKPCKCDYCGKGFSDFSGLRH
HEKIHTGEKPYKCPICEKSFIQRSNFNRHQRVHTGEKPYKCSHCGKSFSWSSSLDKHQRS
HLGKKPFQ
Download sequence
Identical sequences NP_001290211.1.87134 NP_001290211.1.92137 XP_016880497.1.92137 XP_016880498.1.92137 XP_016880499.1.92137 XP_016880500.1.92137 ENSP00000391376 ENSP00000391376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]