SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000392398 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000392398
Domain Number 1 Region: 39-216
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.39e-54
Family Glutathione peroxidase-like 0.000011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000392398   Gene: ENSG00000224586   Transcript: ENST00000412168
Sequence length 221
Comment pep:known chromosome:GRCh38:6:28525925:28534952:1 gene:ENSG00000224586 transcript:ENST00000412168 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTQLRVVHLLPLLLACFVQTSPKQEKMKMDCHKDEKGTIYDYEAIALNKNEYVSFKQYV
GKHILFVNVATYCGLTAQYPELNALQEELKPYGLVVLGFPCNQFGKQEPGDNKEILPGLK
YVRPGGGFVPSFQLFEKGDVNGEKEQKVFSFLKHSCPHPSEILGTFKSISWDPVKVHDIR
WNFEKFLVGPDGIPVMRWSHRATVSSVKTDILAYLKQFKTK
Download sequence
Identical sequences O75715 V9HWN8
NP_001500.1.87134 NP_001500.1.92137 ENSP00000392398 ENSP00000449271 9606.ENSP00000392398 9606.ENSP00000393902 ENSP00000392398 ENSP00000450365 ENSP00000392398 ENSP00000450365 gi|4557629|ref|NP_001500.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]