SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000392508 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000392508
Domain Number 1 Region: 221-350
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.91e-21
Family SPRY domain 0.00079
Further Details:      
 
Domain Number 2 Region: 80-150
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000233
Family RING finger domain, C3HC4 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000392508   Gene: ENSG00000236967   Transcript: ENST00000441449
Sequence length 354
Comment pep:known chromosome:GRCh38:CHR_HSCHR6_MHC_APD_CTG1:30062765:30068348:-1 gene:ENSG00000236967 transcript:ENST00000441449 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWWRDLTRLRLWLKREAIPGEGRKAAKVNAGVGEKGIYTASSRGGPPSARSKAVTVVAEG
AASRSWLSMDAPELGPGLVERLEQLATCPLCGGSFEDPVLLACEHSFCRACLARRWGTPP
ATGTEASPTACPCCGLPCPRRSLRSNVRLAVEVRISRELREKLAEPGARAGRRRGGRIPT
MGCLDLPGEDMRKTWRRFEVPTSKSSNSEDDLPEDYPVVKKMLHRLTADLTLDPGTAHRR
LLISADRRSVQLAPPGTPAPPDGPKRFDQLPAVLGAQGFGAGRHCWEVETADAASCRDSS
GEDADDEESHYAVGAAGESVQRKGCAPGPLGERIFPLFCTCDPRAPLRIVPAES
Download sequence
Identical sequences A0A1U9X8G2
ENSP00000365942 ENSP00000391822 ENSP00000392508 ENSP00000401131 ENSP00000405340 ENSP00000415281 gi|297139767|ref|NP_739575.2| ENSP00000365942 ENSP00000391822 ENSP00000392508 ENSP00000401131 ENSP00000405340 ENSP00000415281 NP_739575.2.87134 NP_739575.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]