SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000394446 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000394446
Domain Number 1 Region: 232-369
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.09e-22
Family Ricin B-like 0.0029
Further Details:      
 
Domain Number 2 Region: 133-228
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 0.0000000000656
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.00012
Further Details:      
 
Domain Number 3 Region: 4-58
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 0.00000187
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000394446   Gene: ENSG00000182870   Transcript: ENST00000411988
Sequence length 376
Comment pep:novel chromosome:GRCh38:12:132196509:132257742:-1 gene:ENSG00000182870 transcript:ENST00000411988 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XIIPPQDWLDRGDESAPIRTPAMIGCSFVVDREYFGDIGLLDPGMEVYGGENVELGMRET
EGFQQDKVNYKQNKRGRKTRQRVKRSRSEAHRAQPSPGATHGAHSRAPGPRTEPTAEPWG
HARPTAALPATGVWQCGGSMEVLPCSRVAHIERTRKPYNNDIDYYAKRNALRAAEVWMDD
FKSHVYMAWNIPMSNPGVDFGDVSERLALRQRLKCRSFKWYLENVYPEMRVYNNTLTYGE
VRNSKASAYCLDQGAEDGDRAILYPCHGMSSQLVRYSADGLLQLGPLGSTAFLPDSKCLV
DDGTGRMPTLKKCEDVARPTQRLWDFTQSGPIVSRATGRCLEVEMSKDANFGLRLVVQRC
SGQKWMIRNWIKHARH
Download sequence
Identical sequences H3BM10
ENSP00000394446 ENSP00000394446 ENSP00000456784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]