SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000396379 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000396379
Domain Number 1 Region: 337-394
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.66e-23
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 2 Region: 46-103
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.06e-23
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 3 Region: 281-338
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.44e-22
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 4 Region: 243-295
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.97e-19
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 5 Region: 379-431
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000151
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Weak hits

Sequence:  ENSP00000396379
Domain Number - Region: 205-254
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0167
Family Classic zinc finger, C2H2 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000396379   Gene: ENSG00000089335   Transcript: ENST00000446502
Sequence length 443
Comment pep:novel chromosome:GRCh38:19:34677717:34686332:1 gene:ENSG00000089335 transcript:ENST00000446502 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQRQYPECYLAPNGCLVSNCGVNKMSNEELVGQNHGMEGEACTGGDVTFSDVAIDFSHE
EWACLDSAQRDLYKDVMVQNYENLVSVGLSVTKPYVIMLLEDGKEPWMMEKKLSKDWESR
WENKELSTKKDIYDEDSPQPVTMEKVVKQSYEFSNSNKNLEYTECDTFRSTFHSKSTLSE
PQNNSAEGNSHKYDILKKNLSKKSVIKSERINGGKKLLNSNKSGAAFNQSKSLTLPQTCN
REKIYTCSECGKAFGKQSILSRHWRIHTGEKPYECRECGKTFSHGSSLTRHQISHSGEKP
YKCIECGKAFSHGSSLTNHQSTHTGEKPYECMNCGKSFSRVSLLIQHLRIHTQEKRYECR
ICGKAFIHSSSLIHHQKSHTGEKPYECRECGKAFCCSSHLTQHQRIHSMKKKYECNKCLK
VFSSFSFLVQHQSIHTEEKPFEV
Download sequence
Identical sequences E7EVR1
ENSP00000396379 ENSP00000421201 ENSP00000396379 NP_001276110.1.87134 NP_001276110.1.92137 XP_016882468.1.92137 XP_016882469.1.92137 XP_016882470.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]