SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000398440 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000398440
Domain Number 1 Region: 59-118
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.94e-25
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 2 Region: 535-592
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.31e-22
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 3 Region: 395-452
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.94e-22
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 4 Region: 339-396
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.37e-22
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 5 Region: 283-340
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.5e-20
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 6 Region: 577-629
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.51e-20
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 7 Region: 493-545
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.14e-19
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 8 Region: 452-508
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.95e-19
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 9 Region: 245-297
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.18e-16
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000398440   Gene: ENSG00000233831   Transcript: ENST00000458265
Sequence length 666
Comment pep:known chromosome:GRCh38:CHR_HSCHR6_MHC_SSTO_CTG1:28995715:29006085:-1 gene:ENSG00000233831 transcript:ENST00000458265 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQEVVLLDESSGPPSQLLWTRQDTQLPQESALLPAPYPAFTKDGSQGNLPQADITLMSQA
QESVTFEDVAVNFTNREWQCLTYAQRHLYKDVMLENYGNMVSLGFPFPKPPLISHLEREV
DPCVQDPQDRESLSCSYPVSADKMWPENEKASSQQEIFENGEAYWMKFNSLLKVDSRDPK
VREVCVQDVKLENQWETSIREKLREEKEGSEEVTCKKGKNQKVLSKNLNPNSKHSQCNKV
LIAQKLHECARCGKNFSWHSDLILHEQIHSGEKPHVCNECGKAFKTRNQLSMHRIIHTGE
KPFNCTQCGKAFNSRSALCRHKKTHSGEKPHECRDCGKAFKTRNRLCMHQLIHTGEKPYK
CNCCGKAFQFKHSLTIHGRIHTGEKPYECEECGKAFSGSSDLTKHIRIHTGERPYECSKC
GRAFSRSSDLSKHKRIHTREKHYGCPQCGKDFSIKAELTKHRRIHTEEKRYRCEECGKAF
RHNCKRRAHEREHTGEKPYQCRDCGKTFQDQHCLTIHQRIHTGEKPYKCLECGKAFSGKS
NLTNHRRIHTGEKPHKCEVCGMAFHHSSVLRQHKRIHTGEKPYTCSECGTSFRQGSALIG
HKRVHTGEKPYECEECGKAFRVSSNLTGHKKRKHQVWSTHELDGSRKSLSPVTVSQTSVV
SILTSA
Download sequence
Identical sequences A0A1U9X8W6
ENSP00000398440 ENSP00000398440 9606.ENSP00000398440 ENSP00000398440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]