SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000399829 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000399829
Domain Number 1 Region: 119-156
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000138
Family EGF-type module 0.011
Further Details:      
 
Domain Number 2 Region: 77-119
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000419
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 3 Region: 40-87
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000434
Family EGF-type module 0.0074
Further Details:      
 
Weak hits

Sequence:  ENSP00000399829
Domain Number - Region: 3-26
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0119
Family EGF-type module 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000399829   Gene: ENSG00000171462   Transcript: ENST00000430324
Sequence length 289
Comment pep:known chromosome:GRCh38:6:43450352:43453085:-1 gene:ENSG00000171462 transcript:ENST00000430324 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XGCQHGTCHQPWQCICHSGWAGKFCDKGFHGRDCERKAGPCEQAGSPCRNGGQCQDDQGF
ALNFTCRCLVGFVGARCEVNVDDCLMRPCANGATCLDGINRFSCLCPEGFAGRFCTINLD
DCASRPCQRGARCRDRVHDFDCLCPSGYGGKTCELVLPVPDPPTTVDTPLGPTSAVVVPA
TGPAPHSAGAGLLRISVKEVVRRQEAGLGEPSLVALVVFGALTAALVLATVLLTLRAWRR
GVCPPGPCCYPAPHYAPACQDQECQVSMLPAGLPLPRDLPPEPGKTTAL
Download sequence
Identical sequences H0Y5P1
ENSP00000399829 ENSP00000399829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]