SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000402103 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000402103
Domain Number 1 Region: 676-915
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 7.2e-86
Family Hexokinase 0.000000000628
Further Details:      
 
Domain Number 2 Region: 227-467
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 2.45e-85
Family Hexokinase 0.000000000714
Further Details:      
 
Domain Number 3 Region: 458-672
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 5.94e-80
Family Hexokinase 0.00000000505
Further Details:      
 
Domain Number 4 Region: 25-225
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 7.29e-76
Family Hexokinase 0.0000000044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000402103   Gene: ENSG00000156515   Transcript: ENST00000448642
Sequence length 921
Comment pep:known chromosome:GRCh38:10:69270000:69401879:1 gene:ENSG00000156515 transcript:ENST00000448642 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQICQRESATAAEKPKLHLLAESEIDKYLYAMRLSDETLIDIMTRFRKEMKNGLSRDFN
PTATVKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKNQNVHMESEVYDTPE
NIVHGSGSQLFDHVAECLGDFMEKRKIKDKKLPVGFTFSFPCQQSKIDEAILITWTKRFK
ASGVEGADVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQHCEVGLIIGTGTNA
CYMEELRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKM
VSGMYLGELVRLILVKMAKEGLLFEGRITPELLTRGKFNTSDVSAIEKNKEGLHNAKEIL
TRLGVEPSDDDCVSVQHVCTIVSFRSANLVAATLGAILNRLRDNKGTPRLRTTVGVDGSL
YKTHPQYSRRFHKTLRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLAEQHRQIEETLAH
FHLTKDMLLEVKKRMRAEMELGLRKQTHNNAVVKMLPSFVRRTPDGTENGDFLALDLGGT
NFRVLLVKIRSGKKRTVEMHNKIYAIPIEIMQGTGEELFDHIVSCISDFLDYMGIKGPRM
PLGFTFSFPCQQTSLDAGILITWTKGFKATDCVGHDVVTLLRDAIKRREEFDLDVVAVVN
DTVGTMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVEMVEGDQGQMCINMEWGAFGDNG
CLDDIRTHYDRLVDEYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKKGFLFRGQISETL
KTRGIFETKFLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTVCGVVSRRAAQLCGA
GMAAVVDKIRENRGLDRLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPKCNVSFLLSEDG
SGKGAALITAVGVRLRTEASS
Download sequence
Identical sequences A0A024QZK7
NP_001309293.1.87134 NP_001309293.1.92137 NP_277032.1.87134 NP_277032.1.92137 NP_277033.1.87134 NP_277033.1.92137 ENSP00000384774 ENSP00000402103 gi|15991829|ref|NP_277032.1| gi|15991831|ref|NP_277033.1| 9606.ENSP00000348697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]