SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000407248 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000407248
Domain Number 1 Region: 221-350
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.41e-20
Family SPRY domain 0.00089
Further Details:      
 
Domain Number 2 Region: 80-150
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000233
Family RING finger domain, C3HC4 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000407248   Gene: ENSG00000237733   Transcript: ENST00000417541
Sequence length 354
Comment pep:known chromosome:GRCh38:CHR_HSCHR6_MHC_MANN_CTG1:30065423:30071006:-1 gene:ENSG00000237733 transcript:ENST00000417541 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWWRDLTRLRLWLKREAIPGEGRKAAKVNAGVGEKGIYTASSRGGPPSARSKAVTVVAEG
AASRSWLSMDAPELGPGLVERLEQLATCPLCGGSFEDPVLLACEHSFCRACLARRWGTPP
ATGTEASPTACPCCGLPCPRRSLRSNVRLAVEVRISRELREKLAEPGARAGRRRGGRIPT
MGCLDLPGEDMRKTWRRFEVPTSKSSNSEDDLPEDYPVVKKMLHRLTADLTLDPGTAHRR
LLISADRRSVQLAPPGTPAPPDGPKRFNQLPAVLGAQGFGAGRHCWEVETADAASCRDSS
GEDADDEESHYAVGAAGESVQRKGCAPGPLGERIFPLFCTCDPRAPLRIVPAES
Download sequence
Identical sequences A0A1U9X8G9
ENSP00000407248 ENSP00000407248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]