SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000408335 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000408335
Domain Number 1 Region: 1579-1821
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.1e-53
Family Ankyrin repeat 0.000000927
Further Details:      
 
Domain Number 2 Region: 478-594
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000408
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 3 Region: 589-626
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000106
Family EGF-type module 0.013
Further Details:      
 
Domain Number 4 Region: 277-319
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000109
Family EGF-type module 0.017
Further Details:      
 
Domain Number 5 Region: 355-480
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000149
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 6 Region: 931-969
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000179
Family EGF-type module 0.0067
Further Details:      
 
Domain Number 7 Region: 768-805
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000254
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 8 Region: 194-233
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000547
Family EGF-type module 0.01
Further Details:      
 
Domain Number 9 Region: 968-1009
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000837
Family EGF-type module 0.015
Further Details:      
 
Domain Number 10 Region: 158-201
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000179
Family EGF-type module 0.011
Further Details:      
 
Domain Number 11 Region: 678-803
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000691
Family Growth factor receptor domain 0.0039
Further Details:      
 
Domain Number 12 Region: 1047-1091
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000073
Family EGF-type module 0.01
Further Details:      
 
Domain Number 13 Region: 1253-1284
Classification Level Classification E-value
Superfamily Notch domain 0.000000196
Family Notch domain 0.0025
Further Details:      
 
Domain Number 14 Region: 236-280
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000255
Family EGF-type module 0.028
Further Details:      
 
Domain Number 15 Region: 1006-1048
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000378
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 16 Region: 314-360
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000642
Family EGF-type module 0.01
Further Details:      
 
Domain Number 17 Region: 810-934
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000785
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 18 Region: 31-64
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000488
Family EGF-type module 0.025
Further Details:      
 
Domain Number 19 Region: 66-116
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000719
Family EGF-type module 0.013
Further Details:      
 
Domain Number 20 Region: 1216-1246
Classification Level Classification E-value
Superfamily Notch domain 0.0000112
Family Notch domain 0.0065
Further Details:      
 
Domain Number 21 Region: 120-156
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000195
Family EGF-type module 0.021
Further Details:      
 
Weak hits

Sequence:  ENSP00000408335
Domain Number - Region: 1175-1204
Classification Level Classification E-value
Superfamily Notch domain 0.00314
Family Notch domain 0.0034
Further Details:      
 
Domain Number - Region: 1089-1126
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00327
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 1134-1172
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00599
Family EGF-type module 0.012
Further Details:      
 
Domain Number - Region: 626-657
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0141
Family EGF-type module 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000408335   Gene: ENSG00000223355   Transcript: ENST00000439349
Sequence length 2003
Comment pep:known chromosome:GRCh38:CHR_HSCHR6_MHC_MCF_CTG1:32271266:32300513:-1 gene:ENSG00000223355 transcript:ENST00000439349 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPPSLLLLLLLLLLLCVSVVRPRGLLCGSFPEPCANGGTCLSLSLGQGTCQCAPGFLGE
TCQFPDPCQNAQLCQNGGSCQALLPAPLGLPSSPSPLTPSFLCTCLPGFTGERCQAQLED
PCPPSFCSKRGRCHIQASGRPQCSCMPGWTGEQCQLRDFCSANPCVNGGVCLATYPQIQC
HCPPGFEGHACERDVNECFQDPGPCPKGTSCHNTLGSFQCLCPVGQEGPRCELRAGPCPP
RGCSNGGTCQLMPEKDSTFHLCLCPPGFIGPDCEVNPDNCVSHQCQNGGTCQDGLDTYTC
LCPETWTGWDCSEDVDECETQGPPHCRNGGTCQNSAGSFHCVCVSGWGGTSCEENLDDCI
AATCAPGSTCIDRVGSFSCLCPPGRTGLLCHLEDMCLSQPCHGDAQCSTNPLTGSTLCLC
QPGYSGPTCHQDLDECLMAQQGPSPCEHGGSCLNTPGSFNCLCPPGYTGSRCEADHNECL
SQPCHPGSTCLDLLATFHCLCPPGLEGQLCEVETNECASAPCLNHADCHDLLNGFQCICL
PGFSGTRCEEDIDECRSSPCANGGQCQDQPGAFHCKCLPGFEGPRCQTEVDECLSDPCPV
GASCLDLPGAFFCLCPSGFTGQLCEVPLCAPNLCQPKQICKDQKDKANCLCPDGSPGCAP
PEDNCTCHHGHCQRSSCVCDVGWTGPECEAELGGCISAPCAHGGTCYPQPSGYNCTCPTG
YTGPTCSEEMTACHSGPCLNGGSCNPSPGGYYCTCPPSHTGPQCQTSTDYCVSAPCFNGG
TCVNRPGTFSCLCAMGFQGPRCEGKLRPSCADSPCRNRATCQDSPQGPRCLCPTGYTGGS
CQTLMDLCAQKPCPRNSHCLQTGPSFHCLCLQGWTGPLCNLPLSSCQKAALSQGIDVSSL
CHNGGLCVDSGPSYFCHCPPGFQGSLCQDHVNPCESRPCQNGATCMAQPSGYLCQCAPGY
DGQNCSKELDACQSQPCHNHGTCTPKPGGFHCACPPGFVGLRCEGDVDECLDQPCHPTGT
AACHSLANAFYCQCLPGHTGQWCEVEIDPCHSQPCFHGGTCEATAGSPLGFICHCPKGFE
GPTCSHRAPSCGFHHCHHGGLCLPSPKPGFPPRCACLSGYGGPDCLTPPAPKGCGPPSPC
LYNGSCSETTGLGGPGFRCSCPHSSPGPRCQKPGAKGCEGRSGDGACDAGCSGPGGNWDG
GDCSLGVPDPWKGCPSHSRCWLLFRDGQCHPQCDSEECLFDGYDCETPPACTPAYDQYCH
DHFHNGHCEKGCNTAECGWDGGDCRPEDGDPEWGPSLALLVVLSPPALDQQLFALARVLS
LTLRVGLWVRKDRDGRDMVYPYPGARAEEKLGGTRDPTYQERAAPQTQPLGKETDSLSAG
FVVVMGVDLSRCGPDHPASRCPWDPGLLLRFLAAMAAVGALEPLLPGPLLAVHPHAGTAP
PANQLPWPVLCSPVAGVILLALGALLVLQLIRRRRREHGALWLPPGFTRRPRTQSAPHRR
RPPLGEDSIGLKALKPKAEVDEDGVVMCSGPEEGEEVGQAEETGPPSTCQLWSLSGGCGA
LPQAAMLTPPQESEMEAPDLDTRGPDGVTPLMSAVCCGEVQSGTFQGAWLGCPEPWEPLL
DGGACPQAHTVGTGETPLHLAARFSRPTAARRLLEAGANPNQPDRAGRTPLHAAVAADAR
EVCQLLLRSRQTAVDARTEDGTTPLMLAARLAVEDLVEELIAAQADVGARDKWGKTALHW
AAAVNNARAARSLLQAGADKDAQDNREQTPLFLAAREGAVEVAQLLLGLGAARELRDQAG
LAPADVAHQRNHWDLLTLLEGAGPPEARHKATPGREAGPFPRARTVSVSVPPHGGGALPR
CRTLSAGAGPRGGGACLQARTWSVDLAARGGGAYSHCRSLSGVGAGGGPTPRGRRFSAGM
RGPRPNPAIMRGRYGVAAGRGGRVSTDDWPCDWVALGACGSASNIPIPPPCLTPSPERGS
PQLDCGPPALQEMPINQGGEGKK
Download sequence
Identical sequences A0A1U9X938
ENSP00000408335 ENSP00000408335 9606.ENSP00000408335 ENSP00000450291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]