SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000409459 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000409459
Domain Number 1 Region: 28-163
Classification Level Classification E-value
Superfamily RNI-like 1.06e-19
Family Cyclin A/CDK2-associated p19, Skp2 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000409459   Gene: ENSG00000125122   Transcript: ENST00000424285
Sequence length 165
Comment pep:known chromosome:GRCh38:16:67207880:67226877:-1 gene:ENSG00000125122 transcript:ENST00000424285 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYSSGWPAGAAEPRHGRGRELAQALGCMHGAPSQLASLSLAHCSSLKSRPELEHQASGTK
DACPEPQGPSLLTLRALQELDLTACSKLTDASLAKVLQFLQLRQLSLSLLPELTDNGLVA
VARGCPSLEHLALSHCSRLSDKGWAQAASSWPRLQHLNLSSCSQL
Download sequence
Identical sequences ENSP00000409459 ENSP00000409459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]